DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and CG6654

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster


Alignment Length:245 Identity:77/245 - (31%)
Similarity:101/245 - (41%) Gaps:37/245 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 SSGFKVEDIL-----NESKINEDEPNNEDDIDYSEMDYLIY-----------ESDTEVDAKQELK 174
            ::||.||..|     .:..||.:...||.:..:...|:|..           |.....|:|:.|.
  Fly   335 NAGFAVEKSLMIHRRQKGCINRNYKCNECEKVFVSPDHLAEHQASHGAHNCPECGIRCDSKEALS 399

  Fly   175 SDSENPKKRRNRRNP--------------RD------SNRTFFCEECGNHIKDRISFILHCKRHR 219
            .......| ||.||.              ||      ..:.|.|..||.......:...|..||.
  Fly   400 KHMVQGHK-RNLRNQCNICQKVFTMLSTLRDHMRIHTGEKPFVCNICGKSFTQNANLRQHKLRHS 463

  Fly   220 GVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFSDYSTRLKHERTHTNERPFVCKE 284
            ..|.|.||.|...|.|.|||..|.|.|||:|||:|..|...|:...:..||:|.||.|||:.|..
  Fly   464 ETKSFKCELCPHSFVTKAELTSHARTHTGDKPFECEVCLARFTTSCSLAKHKRKHTGERPYACDL 528

  Fly   285 CNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHYRSNAHRR 334
            |...||...:||||...||||:.:.|..|.|.|::......|.|::...|
  Fly   529 CPMRFTALNVLKNHRRTHTGERPYVCPFCSKTFTQRGDCQMHQRTHQGER 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 4/19 (21%)
COG5048 222..>276 CDD:227381 25/53 (47%)
C2H2 Zn finger 226..246 CDD:275368 10/19 (53%)
zf-H2C2_2 238..262 CDD:290200 12/23 (52%)
C2H2 Zn finger 254..274 CDD:275368 6/19 (32%)
zf-H2C2_2 269..291 CDD:290200 11/21 (52%)
C2H2 Zn finger 282..302 CDD:275368 8/19 (42%)
zf-H2C2_2 295..319 CDD:290200 12/23 (52%)
C2H2 Zn finger 310..328 CDD:275368 5/17 (29%)
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 5/18 (28%)
COG5048 <357..570 CDD:227381 67/213 (31%)
C2H2 Zn finger 360..380 CDD:275368 4/19 (21%)
C2H2 Zn finger 385..406 CDD:275370 4/20 (20%)
C2H2 Zn finger 414..434 CDD:275368 2/19 (11%)
zf-H2C2_2 427..451 CDD:290200 6/23 (26%)
C2H2 Zn finger 442..490 CDD:275368 18/47 (38%)
C2H2 Zn finger 470..487 CDD:275368 8/16 (50%)
zf-H2C2_2 482..507 CDD:290200 13/24 (54%)
C2H2 Zn finger 498..518 CDD:275368 6/19 (32%)
zf-H2C2_2 510..534 CDD:290200 10/23 (43%)
C2H2 Zn finger 526..546 CDD:275368 8/19 (42%)
zf-H2C2_2 539..563 CDD:290200 12/23 (52%)
C2H2 Zn finger 554..574 CDD:275368 6/19 (32%)
C2H2 Zn finger 582..602 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.