DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and CG14710

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster


Alignment Length:409 Identity:117/409 - (28%)
Similarity:180/409 - (44%) Gaps:76/409 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRTCGKRTNAERSLNIFEKRNQTTL-EHIKLLTGAVLKNCSTLPNRLCASCQTCLQQAISFRERC 69
            ||.|.......:.:.:|..:.::.| :.::|.....::....||.:.|.||...:|...:||:.|
  Fly    10 CRICLGDFEESQMICLFGDKGESDLRKKLELCCRIRVRQSPQLPEKACNSCCEFVQMWFNFRQMC 74

  Fly    70 LEVQ----------RELLHSQDDEDFLRICQES--PKSVLEQEELELDLAEISIEVERLDDLNEG 122
            |..|          .|.|....|.:::....|:  .|...|.:|.| ::..|....|:.:|.::.
  Fly    75 LNSQVYWETSSSERPEALAQASDAEYMLYLYENLHLKLGTENQEKE-EITAIEEGDEQQEDQSQE 138

  Fly   123 PIQSSGFKVEDILNESKINEDEPNNE--DDIDYSEMDYLIYESDTE--VDAKQEL---------- 173
            .:..:||    |:|||...::|||.|  :.|..|.||..:.:...|  :|.|.||          
  Fly   139 VLDFNGF----IINESIEEDEEPNTESPEQILISHMDSYVDDQQMEELIDDKGELVEELSNANTF 199

  Fly   174 ---------------------------------KSDSE--------NPKKRRNRRNPRDSNRTFF 197
                                             |.|:|        |.|:|.|:...::..: |.
  Fly   200 YEVEYGDEELLMSSAPSPHPSFKMDKQKPGRPRKPDAELKFKRKDINAKERGNQPKCKEEEK-FM 263

  Fly   198 CEECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFS 262
            |..|||....:..|..|...|...|...||.|...|....||:.|||:|||::|:||.:|.|.|.
  Fly   264 CILCGNVFYKKSVFTAHMMTHSEYKPHQCEICNKSFRQMGELRAHIRRHTGDRPYKCMYCDRHFY 328

  Fly   263 DYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHY 327
            |.|.|::|||.|||.||:.|:||...||.:.|||||:|.|:.:|.:.|.:|.|.|:....|..|.
  Fly   329 DRSERVRHERVHTNTRPYACQECGKTFTHTAILKNHILSHSAQKNYNCGICCKSFTLLHQLKAHL 393

  Fly   328 RSNAHRRNMQKADTIFDKP 346
            ::..||..|::  ||...|
  Fly   394 QTLTHRNKMEQ--TIPSSP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871 18/81 (22%)
C2H2 Zn finger 198..218 CDD:275368 6/19 (32%)
COG5048 222..>276 CDD:227381 26/53 (49%)
C2H2 Zn finger 226..246 CDD:275368 9/19 (47%)
zf-H2C2_2 238..262 CDD:290200 13/23 (57%)
C2H2 Zn finger 254..274 CDD:275368 10/19 (53%)
zf-H2C2_2 269..291 CDD:290200 12/21 (57%)
C2H2 Zn finger 282..302 CDD:275368 11/19 (58%)
zf-H2C2_2 295..319 CDD:290200 11/23 (48%)
C2H2 Zn finger 310..328 CDD:275368 6/17 (35%)
CG14710NP_650092.4 zf-AD 9..83 CDD:285071 17/72 (24%)
COG5048 <261..395 CDD:227381 57/134 (43%)
C2H2 Zn finger 264..284 CDD:275368 6/19 (32%)
zf-C2H2 290..312 CDD:278523 9/21 (43%)
C2H2 Zn finger 292..312 CDD:275368 9/19 (47%)
zf-H2C2_2 304..327 CDD:290200 13/22 (59%)
C2H2 Zn finger 320..340 CDD:275368 10/19 (53%)
zf-H2C2_2 335..357 CDD:290200 12/21 (57%)
C2H2 Zn finger 348..368 CDD:275368 11/19 (58%)
C2H2 Zn finger 376..395 CDD:275368 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.