DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and CG31388

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster


Alignment Length:443 Identity:108/443 - (24%)
Similarity:166/443 - (37%) Gaps:136/443 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VCRTCGKRTNAERSLNIFEKRNQTTLEHIKLLTGAVLKNCSTLPNRLCASCQTCLQQAISFRERC 69
            :||||.:..:...:.|:|:..:.:.|..|:.||...||....||..:|..||..||.||.||..|
  Fly     4 ICRTCSRMADPAVAKNLFDPSSSSVLRQIETLTNLQLKEDGKLPRFMCQDCQHDLQIAIDFRRVC 68

  Fly    70 LEVQRELLHSQDDEDFLRICQESPKSVLEQEELELDLAEISIEVERLDDL-----NEGPIQSSGF 129
            :|.| |||..|     ||       .|.::||....|||     :.|||.     |..|:.....
  Fly    69 IEAQ-ELLELQ-----LR-------QVEKEEEAFESLAE-----QWLDDCPDELSNLSPVLQLND 115

  Fly   130 KVEDILNESKINEDEPNNEDDI----DYSEMDYL-IYESDTEVDAKQELKSDSE----------N 179
            :::.|.:.    |.:..|.|::    ..:..:|: .|:|.....:..||.:||:          :
  Fly   116 RMDFIFDP----EPQDKNTDELASIKTTTTTEYMNAYQSVASPQSSPELSTDSQLSNEHFDMGLS 176

  Fly   180 PKKRRNRR--NPRDSNRTFFCEECG---------------------------------------- 202
            |:......  :.||::.:..|.:||                                        
  Fly   177 PESEPESEAIDNRDTSSSHTCSKCGLEFENVDELKLHKYHLHDIPPDTKFVCDHCDEGFRSAAAL 241

  Fly   203 -----------------------NHI-----KDR-------------------ISFIL--HCKRH 218
                                   |||     |.|                   .:|.|  |..||
  Fly   242 TRHCNMINLPLTHSCTKCKSQFHNHILLETHKQRCLRPPASQHVCHICGKHLTTAFNLKNHLVRH 306

  Fly   219 RGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRH-CSRSFSDYSTRLKHERTH--TNERPF 280
            .|.:...|:.|...|.|.|||..|.:.||.|:|:.||: |.::|...|.|..|||.|  .::|.:
  Fly   307 AGTRRHKCDQCSASFYTAAELCSHQKTHTTERPYICRYNCGKTFRFCSARSMHERVHMDASKRIY 371

  Fly   281 VCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHYRSNAHR 333
            .|:.|..::.|....:.|...|...:...|::|...|....|..:|.:||||:
  Fly   372 QCEYCPKSYVTPSECRTHQKYHNLTRDHGCEICRISFKTAKHYRSHLKSNAHK 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871 27/71 (38%)
C2H2 Zn finger 198..218 CDD:275368 11/108 (10%)
COG5048 222..>276 CDD:227381 22/56 (39%)
C2H2 Zn finger 226..246 CDD:275368 8/19 (42%)
zf-H2C2_2 238..262 CDD:290200 10/24 (42%)
C2H2 Zn finger 254..274 CDD:275368 9/20 (45%)
zf-H2C2_2 269..291 CDD:290200 7/23 (30%)
C2H2 Zn finger 282..302 CDD:275368 4/19 (21%)
zf-H2C2_2 295..319 CDD:290200 5/23 (22%)
C2H2 Zn finger 310..328 CDD:275368 5/17 (29%)
CG31388NP_650060.1 zf-AD 4..76 CDD:285071 28/72 (39%)
C2H2 Zn finger 228..254 CDD:275368 0/25 (0%)
C2H2 Zn finger 286..306 CDD:275368 3/19 (16%)
C2H2 Zn finger 314..334 CDD:275368 8/19 (42%)
C2H2 Zn finger 342..363 CDD:275368 9/20 (45%)
C2H2 Zn finger 373..393 CDD:275368 4/19 (21%)
C2H2 Zn finger 401..419 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.