DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and CG4820

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001097748.1 Gene:CG4820 / 41344 FlyBaseID:FBgn0037876 Length:362 Species:Drosophila melanogaster


Alignment Length:382 Identity:104/382 - (27%)
Similarity:166/382 - (43%) Gaps:77/382 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRTCGKRTNAERSLNIFEKRNQTTLEHIKLLTGAVLKNCSTLPNRLCASCQTCLQQAISFRERCL 70
            ||||||...|:..|.||....:..|:.::.:|...|:|...|||.:|..||..|.|...||.||.
  Fly     5 CRTCGKTVVADECLQIFTPAGRKLLQCVRSITNCWLQNVQDLPNHICTDCQVLLSQVQKFRRRCA 69

  Fly    71 EVQRELLHSQDDEDFLRICQESPKSVLEQEELELDLAEISIEVERLDDLNEGPIQSSGFKVEDIL 135
            ::::.....:...:.    .|:| :.:||..::...|...:.::.|       :.:|..|:|.| 
  Fly    70 KIEKYFARRRRRMNL----GEAP-AAMEQLRVQQAAAPDPLGIDEL-------MSASDIKIEPI- 121

  Fly   136 NESKINEDE----PNNE------------DDI-----DYSEMDYLIYESDTEVDAKQ-----ELK 174
             :.::.||.    |.|:            :||     ||.|....:..:..|...::     ::|
  Fly   122 -QLQMEEDPQAPYPENQLEQALSYGNAPGEDILPLPEDYGEAQTEVATTTNEPAQRRSKNTAKIK 185

  Fly   175 S-----------------DSENPKKRRNRRNPRDSNRTFFCEECGNHIKDRISFILHCKRHRGVK 222
            |                 |.:.||:..:|..|  |.:...||.||...||..:..:|..||.|.|
  Fly   186 SKKHTMRVGRKLIHVKVIDDKQPKRIVDRNGP--SAKPCICEHCGRQFKDTSNLHVHLLRHTGTK 248

  Fly   223 EFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFSDYSTRLKHERTHTNERPFVCKECNN 287
            .|.|:.|..:..|...|:||..||| |.|:.|..|...:|..|:|::|||.       .||:...
  Fly   249 PFECDQCHQKCYTLHLLRRHQLKHT-EGPYACTFCGLEYSTNSSRVRHERE-------ACKKGRA 305

  Fly   288 AFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHYRSNAH----RRNMQKAD 340
            ..:...|:|.      ||:.|.|::||..|.|..:.|.|..|::|    ||..:|::
  Fly   306 PQSKWEIIKK------GERTFHCEVCDLWFLRAGNFTQHINSSSHIENERRKKRKSN 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871 26/70 (37%)
C2H2 Zn finger 198..218 CDD:275368 7/19 (37%)
COG5048 222..>276 CDD:227381 21/53 (40%)
C2H2 Zn finger 226..246 CDD:275368 6/19 (32%)
zf-H2C2_2 238..262 CDD:290200 10/23 (43%)
C2H2 Zn finger 254..274 CDD:275368 8/19 (42%)
zf-H2C2_2 269..291 CDD:290200 5/21 (24%)
C2H2 Zn finger 282..302 CDD:275368 4/19 (21%)
zf-H2C2_2 295..319 CDD:290200 8/23 (35%)
C2H2 Zn finger 310..328 CDD:275368 7/17 (41%)
CG4820NP_001097748.1 zf-AD 4..75 CDD:285071 26/69 (38%)
C2H2 Zn finger 224..244 CDD:275368 7/19 (37%)
C2H2 Zn finger 252..272 CDD:275368 6/19 (32%)
C2H2 Zn finger 279..297 CDD:275368 6/17 (35%)
C2H2 Zn finger 322..339 CDD:275368 6/16 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.