DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and nom

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster


Alignment Length:347 Identity:114/347 - (32%)
Similarity:175/347 - (50%) Gaps:41/347 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VCRTCGKRTNAERSLNIFEKRNQTTLEHIKLLTGAVLKNCSTLPNRLCASCQTCLQQAISFRERC 69
            |||.||:.....:::.:|:...|..|..|:|:||.:|:.....|:.:|..|||.||.|:.||.:|
  Fly     5 VCRVCGRSRLCPKAVELFKPGRQDILRRIQLITGILLQQIPNAPDMVCFCCQTDLQSAMIFRRQC 69

  Fly    70 LEVQRELLHSQDDEDFLRICQESPKSVLEQEELE-LDLAEISIEVERLDDLNEGPIQSSGFKVED 133
            :..|::         ::.:.|.......|::::| .|.:......:|.......|::     :.|
  Fly    70 ILQQKK---------WVPLLQSDKVGASEEKKVEPNDPSTKKKTTKRRRGRPRMPLE-----IVD 120

  Fly   134 IL--NESKINEDEPNNEDDIDY-----SEMDYLIYESDT---EVDAKQE--LKSDSENPKKRRNR 186
            |:  ||||.:..|....|:.|.     :|.|  ..:||.   |:|...|  |:||.:.|..:.::
  Fly   121 IVVTNESKASAGESVGGDEFDQPVEISNEPD--ATDSDVNLEEIDLPDEDGLESDHDLPNVQIHK 183

  Fly   187 RNPRDSNRTFFCEECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRH-IRKHTGEK 250
                       |:.||....::.|.:.|...|.|::.:.|:.|...|...:|||.| :..||.|.
  Fly   184 -----------CDTCGIIKNNKSSLVRHQFEHNGIRPYPCKECPKTFLVASELKAHNLTHHTLEP 237

  Fly   251 PFKCRHCSRSFSDYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDK 315
            ||.||:|.|.:.....|.||||.|||||||||.:|..|||.:.|||.||.||...:.:.||:||:
  Fly   238 PFACRYCDRRYFSVVGRKKHERVHTNERPFVCDQCGKAFTRTCILKAHMAVHQVVRKYSCDVCDR 302

  Fly   316 LFSRYTHLTTHYRSNAHRRNMQ 337
            .||...||.||:.||.|:||.:
  Fly   303 SFSLKKHLATHFISNTHKRNAE 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871 25/71 (35%)
C2H2 Zn finger 198..218 CDD:275368 5/19 (26%)
COG5048 222..>276 CDD:227381 22/54 (41%)
C2H2 Zn finger 226..246 CDD:275368 7/20 (35%)
zf-H2C2_2 238..262 CDD:290200 13/24 (54%)
C2H2 Zn finger 254..274 CDD:275368 9/19 (47%)
zf-H2C2_2 269..291 CDD:290200 16/21 (76%)
C2H2 Zn finger 282..302 CDD:275368 10/19 (53%)
zf-H2C2_2 295..319 CDD:290200 11/23 (48%)
C2H2 Zn finger 310..328 CDD:275368 10/17 (59%)
nomNP_001262384.1 zf-AD 5..76 CDD:214871 25/79 (32%)
C2H2 Zn finger 184..204 CDD:275368 5/19 (26%)
C2H2 Zn finger 212..261 CDD:275368 21/48 (44%)
zf-H2C2_2 255..278 CDD:290200 16/22 (73%)
C2H2 Zn finger 269..289 CDD:275368 10/19 (53%)
zf-H2C2_2 282..305 CDD:290200 10/22 (45%)
C2H2 Zn finger 297..313 CDD:275368 8/15 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447750
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 1 1.100 - - P PTHR24388
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.