DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and CG17359

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster


Alignment Length:373 Identity:87/373 - (23%)
Similarity:145/373 - (38%) Gaps:82/373 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KVCRTCGKRTNAERSLNIFEK--RNQTTLEHIKLLTGAVLKNCS--------TLPNRLCASCQTC 58
            ::||.|  |..::..|:|:.:  .:...::..:.:...:|:.||        .:|..:|..|...
  Fly     5 QMCRVC--RDESDCLLDIYTEPYASSNRVQEQEPVLATMLRECSGCSVHKEDGMPQFICVECAEA 67

  Fly    59 LQQAISFRERC------LEVQRELLHSQDDEDFL-----RICQESPKSVLE-------QEELELD 105
            ::.|...|.:|      .|..|.::...||.::.     .|..:.|.||:|       .|.|.::
  Fly    68 VRNAYRLRRQCRKSHQYFEQLRLMMKELDDIEYCLNIGDNIEPQMPVSVMEAGKTPETSEPLLVE 132

  Fly   106 LAEISIEVER-------LDDLNEGPIQSSGFKVEDILNESKINEDEPNNEDDIDYSEMDYLIYES 163
            |.::......       |.|.||..:..|....:...|:||....        .||:.|....:|
  Fly   133 LVQVKYMPPEPKPISSPLPDNNEHKLAQSYSPAKTPHNKSKRRAR--------SYSDNDSWSPDS 189

  Fly   164 DTEVDAKQELKSDSENPKKRRNRRNPRDSNRTFFCEECGNHIKDRISFILHCKRHRGVKEFGCEF 228
            :.|.:...::.:.|   |:.:.:|.|                                ..:.|:.
  Fly   190 ELEHEDDDKIWNAS---KRGKPKRVP--------------------------------GPYRCKL 219

  Fly   229 CEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFSDYSTRLKHERTHTNERPFVCKECNNAFTTSY 293
            |...|.....|:.|:|.||||:|:||..|.|||:.......|.|.||.||||.|..|...|....
  Fly   220 CTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVG 284

  Fly   294 ILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHYRSNAHRRNMQKADT 341
            .|:.|...||||:.|:|..|.:.|.:...|..|  .:||.|..::..:
  Fly   285 QLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKH--MSAHTRGKRRTSS 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871 17/87 (20%)
C2H2 Zn finger 198..218 CDD:275368 0/19 (0%)
COG5048 222..>276 CDD:227381 20/53 (38%)
C2H2 Zn finger 226..246 CDD:275368 6/19 (32%)
zf-H2C2_2 238..262 CDD:290200 13/23 (57%)
C2H2 Zn finger 254..274 CDD:275368 7/19 (37%)
zf-H2C2_2 269..291 CDD:290200 11/21 (52%)
C2H2 Zn finger 282..302 CDD:275368 5/19 (26%)
zf-H2C2_2 295..319 CDD:290200 10/23 (43%)
C2H2 Zn finger 310..328 CDD:275368 5/17 (29%)
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 16/83 (19%)
zf-C2H2 215..237 CDD:278523 6/21 (29%)
C2H2 Zn finger 217..237 CDD:275368 6/19 (32%)
zf-H2C2_2 229..254 CDD:290200 14/24 (58%)
C2H2 Zn finger 245..265 CDD:275368 7/19 (37%)
zf-H2C2_2 257..282 CDD:290200 11/24 (46%)
C2H2 Zn finger 273..293 CDD:275368 5/19 (26%)
zf-H2C2_2 286..310 CDD:290200 10/23 (43%)
C2H2 Zn finger 301..321 CDD:275368 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.