DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and ZNF805

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001018857.2 Gene:ZNF805 / 390980 HGNCID:23272 Length:627 Species:Homo sapiens


Alignment Length:367 Identity:92/367 - (25%)
Similarity:142/367 - (38%) Gaps:88/367 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRTCGKRTNAERSLNIFEKRNQTTLEHIKLLTGAVLKNCS------------TLPNR-------- 50
            |..|||..|.:..|.          :|.::.:|.....||            .|.||        
Human   261 CMECGKAFNRKSHLT----------QHQRIHSGEKPYKCSECGKAFTHRSTFVLHNRSHTGEKPF 315

  Fly    51 LCASCQTCLQQAISFRERCLEVQRELLHSQDDEDFLRICQESPKSVLEQEELELDLAEISIEVER 115
            :|..|      ..:||:|...::..::||          .|:|....|..::             
Human   316 VCKEC------GKAFRDRPGFIRHYIIHS----------GENPYECFECGKV------------- 351

  Fly   116 LDDLNEGPIQSSGFKVEDILNESKINEDEPNNEDDIDYSEM------------DYLIYESDTEVD 168
                         ||....|   ..::.....|...:.||.            .|:|:..:...:
Human   352 -------------FKHRSYL---MWHQQTHTGEKPYECSECGKAFCESAALIHHYVIHTGEKPFE 400

  Fly   169 AKQELKSDSENPKKRRNRRNPRDSNRTFFCEECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRF 233
            ..:..|:.:.....:|::| .....:.:.|.|||.......:||||.:.|.|.|.|.|:.|...|
Human   401 CLECGKAFNHRSYLKRHQR-IHTGEKPYVCSECGKAFTHCSTFILHKRAHTGEKPFECKECGKAF 464

  Fly   234 CTPAELKRHIRKHTGEKPFKCRHCSRSFSDYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNH 298
            ...|:|.||...||||||::|..|.::|:..|...:|:|.|:.|:|:.|.||...|..|..|..|
Human   465 SNRADLIRHFSIHTGEKPYECMECGKAFNRRSGLTRHQRIHSGEKPYECIECGKTFCWSTNLIRH 529

  Fly   299 MLVHTGEKAFRCDLCDKLFSRYTHLTTHYRSNAHRRNMQKAD 340
            .::|||||.:.|..|.|.|||.:.||.|.|.:..|..:...|
Human   530 SIIHTGEKPYECSECGKAFSRSSSLTQHQRMHTGRNPISVTD 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871 18/90 (20%)
C2H2 Zn finger 198..218 CDD:275368 8/19 (42%)
COG5048 222..>276 CDD:227381 22/53 (42%)
C2H2 Zn finger 226..246 CDD:275368 7/19 (37%)
zf-H2C2_2 238..262 CDD:290200 11/23 (48%)
C2H2 Zn finger 254..274 CDD:275368 6/19 (32%)
zf-H2C2_2 269..291 CDD:290200 9/21 (43%)
C2H2 Zn finger 282..302 CDD:275368 7/19 (37%)
zf-H2C2_2 295..319 CDD:290200 11/23 (48%)
C2H2 Zn finger 310..328 CDD:275368 9/17 (53%)
ZNF805NP_001018857.2 KRAB 13..73 CDD:214630
KRAB 13..52 CDD:279668
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..95
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..162
COG5048 192..568 CDD:227381 91/362 (25%)
C2H2 Zn finger 205..225 CDD:275368
zf-H2C2_2 218..241 CDD:290200
C2H2 Zn finger 233..253 CDD:275368
zf-H2C2_2 245..270 CDD:290200 4/8 (50%)
C2H2 Zn finger 261..281 CDD:275368 7/29 (24%)
zf-H2C2_2 273..298 CDD:290200 5/34 (15%)
C2H2 Zn finger 289..309 CDD:275368 5/19 (26%)
zf-H2C2_2 305..324 CDD:290200 4/24 (17%)
C2H2 Zn finger 317..337 CDD:275368 5/25 (20%)
zf-C2H2 343..365 CDD:278523 4/50 (8%)
C2H2 Zn finger 345..365 CDD:275368 4/48 (8%)
zf-H2C2_2 357..380 CDD:290200 4/25 (16%)
C2H2 Zn finger 373..393 CDD:275368 3/19 (16%)
zf-C2H2 399..421 CDD:278523 3/22 (14%)
C2H2 Zn finger 401..421 CDD:275368 3/20 (15%)
zf-H2C2_2 413..438 CDD:290200 6/25 (24%)
C2H2 Zn finger 429..449 CDD:275368 8/19 (42%)
zf-H2C2_2 445..466 CDD:290200 8/20 (40%)
C2H2 Zn finger 457..477 CDD:275368 7/19 (37%)
zf-H2C2_2 469..494 CDD:290200 12/24 (50%)
C2H2 Zn finger 485..505 CDD:275368 6/19 (32%)
zf-H2C2_2 498..520 CDD:290200 8/21 (38%)
C2H2 Zn finger 513..533 CDD:275368 7/19 (37%)
zf-H2C2_2 525..550 CDD:290200 11/24 (46%)
C2H2 Zn finger 541..561 CDD:275368 10/19 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.