DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and CG7386

DIOPT Version :10

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_648036.1 Gene:CG7386 / 38719 FlyBaseID:FBgn0035691 Length:662 Species:Drosophila melanogaster


Alignment Length:464 Identity:104/464 - (22%)
Similarity:155/464 - (33%) Gaps:165/464 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TTLEHIKLLTG----------AVLKNCST--------LPNRLCASCQTCLQQAISFRERCLE-VQ 73
            |.|.|:|...|          ..|:.|::        .|..||..|.|.|.....|||.|.| ::
  Fly    13 TCLVHLKHGAGHDLFVVPDLFQKLRACTSFDADQNDGFPRNLCTQCFTKLNDLHDFRELCAESIK 77

  Fly    74 R--ELLHSQ---------------------------------------DDEDFLRICQESPKSVL 97
            |  |::.||                                       ::||..::.::..|   
  Fly    78 RLKEMMTSQRNMPMGVFESIADDSEAPERPEEPASFDPLLNNKLEMIDNEEDVFKLLEKVDK--- 139

  Fly    98 EQEELELDLAEISIEVERLDDLNEGPIQSSGFKVED--------ILN------------------ 136
            |.||...|.:|........:.|.|...:|.||..:|        |.|                  
  Fly   140 ELEEHSRDQSEEHFSSAEHNGLEEEKKESEGFNSDDEQAMGQRRIANDKRKLFRLMSCSICQQKF 204

  Fly   137 --ESKINEDEPNNEDDIDYS------------------EMDYLIYESDTEVDAKQE--------L 173
              :||..|...::.|.:.:.                  .:||...:.:..|....|        |
  Fly   205 KKQSKFEEHMKHHNDLLPFQCQEESCRKGFTTAGALRLHVDYAHSKKEDTVPCTVEGCQLVFSRL 269

  Fly   174 KSDSENPKKRRNRRN---PRDSNRTFFCEECG--------------NHIKDRISFIL-------- 213
            :..:.:.||..|:..   ||....   |:|||              .|..:.:.:..        
  Fly   270 RLLTIHLKKVHNQARVIAPRGEQS---CKECGVVFRCPVAMKKHMYTHTGEELPYPCTICGKGFY 331

  Fly   214 -------HCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFSDYSTRLK-- 269
                   |..||.|:|.:.|::|..|..|..|..:||..||....||||.|     ||:|..|  
  Fly   332 INSALKNHLLRHAGIKNYVCQYCGVRKTTRQEWSKHILIHTQRNQFKCRIC-----DYATHTKRV 391

  Fly   270 ---HER-THTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHYRSN 330
               |.: .|...|.|.|:.|...|..:|..|.|.:.|||||...|.:|||.|.....|..|.:  
  Fly   392 LESHVKIVHEKIRNFACQYCGKTFGKAYACKIHEMAHTGEKRCECKVCDKKFLHSESLNNHLK-- 454

  Fly   331 AHRRNMQKA 339
            .|.:::::|
  Fly   455 IHEKSVERA 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..76 CDD:462262 19/68 (28%)
C2H2 Zn finger 198..218 CDD:275368 6/48 (13%)
COG5048 222..>276 CDD:227381 21/59 (36%)
C2H2 Zn finger 226..246 CDD:275368 7/19 (37%)
zf-H2C2_2 238..262 CDD:463886 10/23 (43%)
C2H2 Zn finger 254..274 CDD:275368 8/25 (32%)
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
zf-H2C2_2 295..319 CDD:463886 12/23 (52%)
C2H2 Zn finger 310..328 CDD:275368 7/17 (41%)
CG7386NP_648036.1 zf-AD 10..81 CDD:214871 19/67 (28%)
C2H2 Zn finger 197..217 CDD:275368 3/19 (16%)
C2H2 Zn finger 294..314 CDD:275368 4/19 (21%)
C2H2 Zn finger 323..343 CDD:275368 1/19 (5%)
C2H2 Zn finger 351..371 CDD:275368 7/19 (37%)
C2H2 Zn finger 379..400 CDD:275368 8/25 (32%)
C2H2 Zn finger 408..428 CDD:275368 6/19 (32%)
C2H2 Zn finger 436..456 CDD:275368 7/21 (33%)
C2H2 Zn finger 534..555 CDD:275368
C2H2 Zn finger 563..583 CDD:275368
zf-H2C2_2 575..600 CDD:463886
C2H2 Zn finger 591..611 CDD:275368
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.