DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and ZKSCAN4

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_061983.2 Gene:ZKSCAN4 / 387032 HGNCID:13854 Length:545 Species:Homo sapiens


Alignment Length:331 Identity:91/331 - (27%)
Similarity:147/331 - (44%) Gaps:60/331 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LCASCQTCLQQAISFRERCLEV----QRELLHSQDDED-FLRI--------CQE--------SPK 94
            ||.......|...|...:|..:    :.|.|.||...| .|::        |:|        :|.
Human   152 LCCKMALLTQTQGSQSSQCQPMKALFKHESLGSQPLHDRVLQVPGLAQGGCCREDAMVASRLTPG 216

  Fly    95 S--VLEQEEL---------ELDLAEISIEVERLDDLNEGPIQSSGFKVE----DILNESKINEDE 144
            |  :|:.|::         :||.:::::..:...: |...:.|.|.:::    |:....|:.|.|
Human   217 SQGLLKMEDVALTLTPGWTQLDSSQVNLYRDEKQE-NHSSLVSLGGEIQTKSRDLPPVKKLPEKE 280

  Fly   145 PN-----NEDDIDYSEMDYLIYESDTEVDAKQELKSDSENPKKRRNRRNPRDSNRTFFCEECGNH 204
            ..     .||          |.:..|..:|.:      :..:.:|.::|...|.| .:|.|||..
Human   281 HGKICHLRED----------IAQIPTHAEAGE------QEGRLQRKQKNAIGSRR-HYCHECGKS 328

  Fly   205 IKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFSDYSTRLK 269
            .........|.:.|.|.|.:.||.|...|...:.|..|.|.||||||::|..|.:.||..|..:|
Human   329 FAQSSGLTKHRRIHTGEKPYECEDCGKTFIGSSALVIHQRVHTGEKPYECEECGKVFSHSSNLIK 393

  Fly   270 HERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHYRSNAHRR 334
            |:||||.|:|:.|.:|...|:.|..|..|..:|||||.::|::|.|.|.|.:||..|.|.:.. :
Human   394 HQRTHTGEKPYECDDCGKTFSQSCSLLEHHKIHTGEKPYQCNMCGKAFRRNSHLLRHQRIHGD-K 457

  Fly   335 NMQKAD 340
            |:|..:
Human   458 NVQNPE 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871 6/29 (21%)
C2H2 Zn finger 198..218 CDD:275368 5/19 (26%)
COG5048 222..>276 CDD:227381 24/53 (45%)
C2H2 Zn finger 226..246 CDD:275368 7/19 (37%)
zf-H2C2_2 238..262 CDD:290200 11/23 (48%)
C2H2 Zn finger 254..274 CDD:275368 8/19 (42%)
zf-H2C2_2 269..291 CDD:290200 11/21 (52%)
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
zf-H2C2_2 295..319 CDD:290200 11/23 (48%)
C2H2 Zn finger 310..328 CDD:275368 8/17 (47%)
ZKSCAN4NP_061983.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..55
SCAN 49..160 CDD:128708 2/7 (29%)
KRAB 221..281 CDD:214630 10/60 (17%)
zf-C2H2 320..342 CDD:306579 5/21 (24%)
C2H2 Zn finger 322..342 CDD:275368 5/19 (26%)
zf-H2C2_2 335..357 CDD:316026 7/21 (33%)
C2H2 Zn finger 350..370 CDD:275368 7/19 (37%)
COG5048 <374..544 CDD:227381 37/91 (41%)
C2H2 Zn finger 378..398 CDD:275368 8/19 (42%)
C2H2 Zn finger 406..426 CDD:275368 6/19 (32%)
C2H2 Zn finger 434..454 CDD:275368 9/19 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 455..480 2/10 (20%)
C2H2 Zn finger 489..509 CDD:275368
C2H2 Zn finger 517..537 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.