DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and CG10321

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001261124.1 Gene:CG10321 / 37464 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster


Alignment Length:540 Identity:101/540 - (18%)
Similarity:175/540 - (32%) Gaps:227/540 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TCGKRTNAE-------------RSLNIFEKRNQT-TLEHIKLL-----------TGAVLKNCSTL 47
            |.|:.|.|:             ::|.|.::.|.| ||:.::|:           |.....|.:.:
  Fly   255 TNGQATAAQSQFLPQLLQTPNGQTLQIVQQPNGTQTLQLVQLVPQRSLAPTGVTTVTTTTNATDM 319

  Fly    48 PNRLCASCQTC----LQQAISFRERCLEVQRELLHSQDD-------------EDFLRICQESPKS 95
            ...:.||....    |:......:..||...|.|.|:.|             :|||:...|..:.
  Fly   320 GQHVGASLGDADVQLLEDGCEVEDEELEDVYEQLDSKADHSFETIVLDDDQQQDFLKDHHEHHQV 384

  Fly    96 VLEQEELELDLAEISIEVERLDDLNEGPIQSSGFKVED--------------ILNESKINEDE-- 144
            ::.::..:.:    |.:.|..|||::   |.:..::||              |:.|.::.:||  
  Fly   385 MINEDLTQSE----SQDHEYFDDLDQ---QQAMDEIEDEEEQMKPEEDQDTFIIEEIQLEDDEML 442

  Fly   145 --PNNE----------------------DDIDYSEMDYLIYESDTEVDA-------------KQE 172
              |:.|                      ||::||.|:....|:..::|.             ::|
  Fly   443 DDPDGEEIDQDCEYIGEEQDPHLSGDVDDDLEYSIMEPPDGETSVDIDQAFMDSEQSHHQQHQEE 507

  Fly   173 LKSDS-EN----------------------------PK--KRRNRRNPR---------------- 190
            ::|.| ||                            ||  ||.|.:.|.                
  Fly   508 MQSISLENAVVEFSQATTTTEALVGPTMTVSSASPTPKRAKRSNHQIPAGVTLEPCDHQPPAAGS 572

  Fly   191 --------------------------------DSNRT---------------FFCEECG------ 202
                                            |:|..               :.|..|.      
  Fly   573 TTSSKLAAANSRQLVQTASVIAAAGADDNYEIDANLVTEFIRQHTSPLGSGRYICHLCSTEFRQF 637

  Fly   203 ----NHIKDRISFI-LHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEK--PFKCRHCSRS 260
                ||:....::| .:||     |:..|:.|...|..|..|:.|::.|..|.  |. |..|:|:
  Fly   638 KGLQNHMHSHTNWIRANCK-----KQPQCQICLKSFKGPGMLRMHMKTHDAESSTPM-CTICNRT 696

  Fly   261 FSDYSTRLKHERTHTNERPFVC--KECNNAFTTSYILKNHM------LVHTGEKAFRCDLCDKLF 317
            |...:...:|.:|| .:|.:.|  ..|...|:::..||.|:      :|   :..|:|..|..|:
  Fly   697 FKSKAILYRHRQTH-QQRAYCCGVANCRKNFSSAVNLKWHVERKHPEVV---DPLFKCGECGSLY 757

  Fly   318 SRYTHLTTHYRSNAHRRNMQ 337
            .....|..|..|..|...:|
  Fly   758 DNVDSLQLHVESTDHSAEVQ 777

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871 19/97 (20%)
C2H2 Zn finger 198..218 CDD:275368 7/30 (23%)
COG5048 222..>276 CDD:227381 17/55 (31%)
C2H2 Zn finger 226..246 CDD:275368 6/19 (32%)
zf-H2C2_2 238..262 CDD:290200 8/25 (32%)
C2H2 Zn finger 254..274 CDD:275368 5/19 (26%)
zf-H2C2_2 269..291 CDD:290200 7/23 (30%)
C2H2 Zn finger 282..302 CDD:275368 6/27 (22%)
zf-H2C2_2 295..319 CDD:290200 8/29 (28%)
C2H2 Zn finger 310..328 CDD:275368 5/17 (29%)
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871
ASF1_hist_chap <405..516 CDD:304562 20/113 (18%)
C2H2 Zn finger 627..647 CDD:275368 4/19 (21%)
C2H2 Zn finger 661..681 CDD:275368 6/19 (32%)
C2H2 Zn finger 690..710 CDD:275368 5/19 (26%)
C2H2 Zn finger 717..740 CDD:275368 6/22 (27%)
C2H2 Zn finger 750..767 CDD:275368 4/16 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.