DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and CG11906

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_611402.2 Gene:CG11906 / 37209 FlyBaseID:FBgn0034425 Length:634 Species:Drosophila melanogaster


Alignment Length:415 Identity:83/415 - (20%)
Similarity:129/415 - (31%) Gaps:129/415 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRTCG----KRTNAERSLNIFEK--RNQTTLEHIKLLTGAVLKNCS---TLPNR--------LCA 53
            |..||    :|....:.|....|  |.|.....:|.   .||...|   ..|:|        .|.
  Fly   201 CHECGRAYFRRDYYAQHLRRCSKTRRKQPRPSRVKC---RVLNEASYDEEAPSRAIRSSRIYYCR 262

  Fly    54 SCQTCLQQAISFR--ERCLEVQR---ELLHSQDD-----EDFLRICQESPKSVLEQEELELDLAE 108
            .|....:..||.|  ||....||   :|..:|.|     |....|||...:::...|:.|.....
  Fly   263 HCDAEFETLISKRQHERMKHQQRYPCDLCEAQLDTKYEWEMHHTICQAKQEALAIVEQQEAGQTV 327

  Fly   109 ISIEVERL-----------------------DDLNEGPIQSSGFKVED----------------- 133
            ::..|.|.                       :|..:..|:|.|.::|:                 
  Fly   328 MTSRVPRACSMRSRSRACSEAWDRYDMDEEEEDEEDEEIESGGEELEEGEEDAMYARRMNFTGDW 392

  Fly   134 ILNESKINEDEPNNEDDIDYSEMDYLIYESDTEVDAKQE------LKSDSENPKKRRNRRNPRDS 192
            |:|.|:.|.   |:..::.....||.:.|:....|.:.:      ||:            ..|..
  Fly   393 IVNHSRSNS---NSAGNLSLLYGDYGMVETHMTTDKEYDLYLLDLLKT------------QVRLK 442

  Fly   193 NRTFFCEECGNHIKDRISFILH-CKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRH 256
            :.|.|..:||......::.:.| ...|..:..|.|..|.|.|                       
  Fly   443 SFTCFTPDCGYQTDTLVALMKHDYMEHWKMSWFYCHKCGDVF----------------------- 484

  Fly   257 CSRSFSDYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYT 321
            .|:.|.||...|:      |...::|.:|...|...:.|..|..:|.....:.|:.|...|....
  Fly   485 TSKVFLDYHMHLQ------NRGLYICHKCREEFELQHQLDRHFQLHRKGINYHCNFCRLEFLSEA 543

  Fly   322 HLTTHYRSNAHRRNMQKADTIFDKP 346
            .|..|.:...|..|        |:|
  Fly   544 KLLAHCKKLGHSPN--------DEP 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871 23/92 (25%)
C2H2 Zn finger 198..218 CDD:275368 3/20 (15%)
COG5048 222..>276 CDD:227381 10/53 (19%)
C2H2 Zn finger 226..246 CDD:275368 4/19 (21%)
zf-H2C2_2 238..262 CDD:290200 1/23 (4%)
C2H2 Zn finger 254..274 CDD:275368 5/19 (26%)
zf-H2C2_2 269..291 CDD:290200 4/21 (19%)
C2H2 Zn finger 282..302 CDD:275368 5/19 (26%)
zf-H2C2_2 295..319 CDD:290200 6/23 (26%)
C2H2 Zn finger 310..328 CDD:275368 5/17 (29%)
CG11906NP_611402.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.