DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and CG17328

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster


Alignment Length:335 Identity:84/335 - (25%)
Similarity:125/335 - (37%) Gaps:76/335 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KVCRTCGKRTNAERSLNIFEKRNQTTLEHIKLLTGAVLKNCST--------LPNRLCASCQTCLQ 60
            |:||.|.:..:...|:...:         ..::...:|..|:.        ||:.:|.:|...|.
  Fly     7 KICRVCLEELHPVTSIYSTD---------FAMMPSVMLMQCAKIRVFKTDGLPSVICNNCIYRLG 62

  Fly    61 QAISFRERCLEVQRELLHSQDDEDFLRICQESPKSVLEQEELELDLAE-ISIEVERLDDLNEGPI 124
            .|..|::.|                              |..:|.|.: :.|    |:...:...
  Fly    63 VAFHFKQEC------------------------------ENSDLRLRQYLGI----LESWRQDAA 93

  Fly   125 QSSGFKVEDILNESKINEDEPNNEDDIDYSEMDYLIYESDTEVDAKQELKSD--SENPKKRRNRR 187
            .::.|..:.:|.:...:|:||                     ||||...:..  ...|.:...:|
  Fly    94 TNTDFVEKPLLPQRDSDEEEP---------------------VDAKVSKRRSRYQRKPPEEHKKR 137

  Fly   188 NPRD-SNRTFFCEECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKP 251
            .|:. ......|.||....|.......|.:.|.|.|.:.|.||..||.....||.|.|.|||:||
  Fly   138 GPKPVPKMPHTCYECHKSFKCIAQLTQHIRTHTGEKPYQCSFCIQRFAQKYNLKVHERTHTGDKP 202

  Fly   252 FKCRHCSRSFSDYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKL 316
            |:|..||:.||.......|::.|...|..||..|...|.|:..|..||:.|||.|...||:|.|.
  Fly   203 FQCEICSKQFSALGNFQAHQKIHLGVRDQVCSLCQKGFYTAGDLSKHMITHTGIKNHHCDVCGKA 267

  Fly   317 FSRYTHLTTH 326
            |||...:.||
  Fly   268 FSRRRDMRTH 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871 14/79 (18%)
C2H2 Zn finger 198..218 CDD:275368 5/19 (26%)
COG5048 222..>276 CDD:227381 23/53 (43%)
C2H2 Zn finger 226..246 CDD:275368 9/19 (47%)
zf-H2C2_2 238..262 CDD:290200 13/23 (57%)
C2H2 Zn finger 254..274 CDD:275368 6/19 (32%)
zf-H2C2_2 269..291 CDD:290200 7/21 (33%)
C2H2 Zn finger 282..302 CDD:275368 7/19 (37%)
zf-H2C2_2 295..319 CDD:290200 12/23 (52%)
C2H2 Zn finger 310..328 CDD:275368 9/17 (53%)
CG17328NP_609786.2 zf-AD 8..80 CDD:214871 17/110 (15%)
COG5048 146..>211 CDD:227381 26/64 (41%)
C2H2 Zn finger 149..169 CDD:275368 5/19 (26%)
C2H2 Zn finger 177..197 CDD:275368 9/19 (47%)
zf-H2C2_2 189..213 CDD:404364 13/23 (57%)
C2H2 Zn finger 205..225 CDD:275368 6/19 (32%)
C2H2 Zn finger 233..253 CDD:275368 7/19 (37%)
zf-H2C2_2 245..270 CDD:404364 12/24 (50%)
C2H2 Zn finger 261..282 CDD:275368 9/17 (53%)
C2H2 Zn finger 318..338 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.