DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and sna

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_476732.1 Gene:sna / 34908 FlyBaseID:FBgn0003448 Length:390 Species:Drosophila melanogaster


Alignment Length:238 Identity:65/238 - (27%)
Similarity:99/238 - (41%) Gaps:48/238 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 SPKSVLEQEELE------LDLAEISIEVERLDDLNEGPIQSSGFKVEDILNESKINEDEPNNEDD 150
            ||:||...:::.      .|| |...|.|.|...|:.|:.:    :..:.:|:|.:....:....
  Fly   160 SPQSVYSYQQMTPPSSPGSDL-ETGSEPEDLSVRNDIPLPA----LFHLFDEAKSSSSGASVSSS 219

  Fly   151 IDYSEMDYLIYESDT-----------EVDAKQELKSDSENPKKRRNRRNP----RDSNRTFFCEE 200
            ..||....:...|.:           :.|..|::.|.|....|.|....|    ....:|..|||
  Fly   220 SGYSYTPAMSASSASVAANHAKNYRFKCDECQKMYSTSMGLSKHRQFHCPAAECNQEKKTHSCEE 284

  Fly   201 CGN----------HIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCR 255
            ||.          ||:   :..|.||         |..|...|..|..|:.|||.|||||||:|.
  Fly   285 CGKLYTTIGALKMHIR---THTLPCK---------CPICGKAFSRPWLLQGHIRTHTGEKPFQCP 337

  Fly   256 HCSRSFSDYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNH 298
            .|.|||:|.|....|::||.:.:.:.|:.|:.:|:...:|..|
  Fly   338 DCPRSFADRSNLRAHQQTHVDVKKYACQVCHKSFSRMSLLNKH 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 10/29 (34%)
COG5048 222..>276 CDD:227381 25/53 (47%)
C2H2 Zn finger 226..246 CDD:275368 8/19 (42%)
zf-H2C2_2 238..262 CDD:290200 15/23 (65%)
C2H2 Zn finger 254..274 CDD:275368 8/19 (42%)
zf-H2C2_2 269..291 CDD:290200 6/21 (29%)
C2H2 Zn finger 282..302 CDD:275368 5/17 (29%)
zf-H2C2_2 295..319 CDD:290200 2/4 (50%)
C2H2 Zn finger 310..328 CDD:275368
snaNP_476732.1 C2H2 Zn finger 308..328 CDD:275368 8/19 (42%)
zf-H2C2_2 321..344 CDD:290200 15/22 (68%)
zf-C2H2 334..356 CDD:278523 9/21 (43%)
C2H2 Zn finger 336..356 CDD:275368 8/19 (42%)
zf-H2C2_2 348..373 CDD:290200 6/24 (25%)
C2H2 Zn finger 364..380 CDD:275368 4/15 (27%)
C2H2 Zn finger 247..267 CDD:275368 6/19 (32%)
C2H2 Zn finger 282..302 CDD:275368 7/22 (32%)
zf-C2H2 306..328 CDD:278523 10/30 (33%)
COG5048 307..>356 CDD:227381 24/57 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.