DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and CG13123

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_609315.1 Gene:CG13123 / 34303 FlyBaseID:FBgn0032150 Length:323 Species:Drosophila melanogaster


Alignment Length:348 Identity:76/348 - (21%)
Similarity:129/348 - (37%) Gaps:110/348 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KVCRTCGKRTNAERSLNIFEKR-----NQTTLEHIKLLTG--AVLKNCSTLPNRLCASC-QTCLQ 60
            |:||.|...:   .|::|.|.|     :||.|:.|:.:.|  ..|.....|| .:|..| :.|||
  Fly     5 KLCRICFVDS---ASVDIREHRSGGSSDQTVLQLIEAMFGWNIALNLTEELP-MICNDCLEDCLQ 65

  Fly    61 QAISFRERCLEVQRELLHSQDDEDFLRICQESPKSVLEQEELELDLAEISIEVERLDDLNEGPIQ 125
            |...||:... ..::||...::.: :.:||....:..|:.|     .:.|.|.|.|::....|  
  Fly    66 QYAFFRKLTF-ANQQLLQLYNEAE-VEMCQVKMDATEEEPE-----NQASDEFEILEEFRRIP-- 121

  Fly   126 SSGFKVEDILNESKINEDEPN--------------------NED-----------------DIDY 153
                     |:...::.|.|.                    |:|                 |:..
  Fly   122 ---------LDYVVLDPDRPTETRQTRRRTDSCTKPSQRLANQDSLIVSEFLPATTAQPRLDLSD 177

  Fly   154 SEMDYL---IYESDTEVDAKQELKSDSENPKKRRNRRNPRDSNRTFFCEECGNHIKDRISFILHC 215
            |:::.|   .||..|...|..||        |..|.....::||....|..|:.           
  Fly   178 SQLEQLESPAYEMRTVDYAAVEL--------KHYNLDEYNEANRLLDVEPSGSQ----------- 223

  Fly   216 KRHRGVKEFGCEFCEDRFCTPAELKRHIR-KHTGEKPFKCRHCSRSFS---DYSTRLKHERTHTN 276
                  ..:.|::|...:.:|..||.|:| .|.      |::|:.:|:   |.:..::.:..|..
  Fly   224 ------AIYKCQYCPLAYASPQYLKTHVRNSHV------CKYCTTAFAKVRDLNEHIRQKHPHHQ 276

  Fly   277 ERPFVCKECNNAFTTSYILKNHM 299
                 |..|:|.|:||..|:.|:
  Fly   277 -----CVVCSNNFSTSSNLRAHL 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871 23/79 (29%)
C2H2 Zn finger 198..218 CDD:275368 2/19 (11%)
COG5048 222..>276 CDD:227381 13/57 (23%)
C2H2 Zn finger 226..246 CDD:275368 7/20 (35%)
zf-H2C2_2 238..262 CDD:290200 7/24 (29%)
C2H2 Zn finger 254..274 CDD:275368 4/22 (18%)
zf-H2C2_2 269..291 CDD:290200 5/21 (24%)
C2H2 Zn finger 282..302 CDD:275368 8/18 (44%)
zf-H2C2_2 295..319 CDD:290200 2/5 (40%)
C2H2 Zn finger 310..328 CDD:275368
CG13123NP_609315.1 zf-AD 6..82 CDD:285071 24/80 (30%)
PHA00733 175..272 CDD:177301 26/127 (20%)
C2H2 Zn finger 228..245 CDD:275368 5/16 (31%)
C2H2 Zn finger 251..272 CDD:275368 4/20 (20%)
C2H2 Zn finger 277..298 CDD:275368 8/18 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.