DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and prg

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001260253.1 Gene:prg / 34177 FlyBaseID:FBgn0285971 Length:558 Species:Drosophila melanogaster


Alignment Length:387 Identity:103/387 - (26%)
Similarity:159/387 - (41%) Gaps:78/387 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRTCGKRTNAERSLNIFEK-----RNQTTLEHIKLLTGAVLKNCSTLPNRLCASCQTCLQQAISF 65
            ||.|...|: ..|||||:.     ::.:..|..|.|..........|...:|:.|...|::|...
  Fly    17 CRLCHHNTD-PNSLNIFDDTVQFCKDVSIAEVSKSLWSVQYDRNECLSELICSRCLEILEEAFEL 80

  Fly    66 RERCLEVQRELLHSQDDEDFLRICQESPK---------SVLEQEE----LELD---LAEISIEVE 114
            |:...|.::.|     .|....:.::.||         .|...||    :|:|   |||.|.|  
  Fly    81 RKGMQEREQSL-----QEQLKEMIKDHPKHRPGLNGNPGVFVPEEGCIIVEVDPENLAESSEE-- 138

  Fly   115 RLDDLNEGPIQSSGFKVEDILNESKINEDEPNNEDDIDYSEMDYLIYESDTEVD----------A 169
                  |..:.|.| :.|        |.|:.:.|::.||.|.|....::..:||          |
  Fly   139 ------EFALGSDG-EYE--------NYDDDDEEEEEDYDEEDEEDGQNGEDVDMPLGMDAAQMA 188

  Fly   170 KQELKSDSENPKKRRNRR----------------------NPRDSNRTFFCEECGNHIKDRISFI 212
            .|:..:::.|..:.|.:|                      ...|.|..:.|..|...:..|.:.|
  Fly   189 AQQSVANNANTTEARPKRAFLCQYCDLGFTLPAECQEHELAAHDPNAPYCCNFCNIKLVTRPALI 253

  Fly   213 LHCKR-HRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFSDYSTRLKHERTHTN 276
            .|.|. |...:.:.|..|...|...::||:|...|||.:||.|..||:|||..:...||.|.|:.
  Fly   254 SHIKTLHDPDRPYVCAHCRKGFVRRSDLKKHTIVHTGVRPFTCNVCSKSFSRNTNLTKHMRIHSG 318

  Fly   277 ERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHYRSNAHRRNMQK 338
            .:||||::|..:|.|:..:..|...|...|||:|..|...|||...|..|.:.:. ||:|::
  Fly   319 VKPFVCQQCPRSFQTAVEMMRHTRSHGEVKAFQCGRCPYSFSRRDKLIAHQQVHT-RRDMEQ 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871 19/75 (25%)
C2H2 Zn finger 198..218 CDD:275368 6/20 (30%)
COG5048 222..>276 CDD:227381 21/53 (40%)
C2H2 Zn finger 226..246 CDD:275368 6/19 (32%)
zf-H2C2_2 238..262 CDD:290200 12/23 (52%)
C2H2 Zn finger 254..274 CDD:275368 9/19 (47%)
zf-H2C2_2 269..291 CDD:290200 10/21 (48%)
C2H2 Zn finger 282..302 CDD:275368 5/19 (26%)
zf-H2C2_2 295..319 CDD:290200 8/23 (35%)
C2H2 Zn finger 310..328 CDD:275368 7/17 (41%)
prgNP_001260253.1 zf-AD 16..94 CDD:285071 20/82 (24%)
COG5048 <212..340 CDD:227381 37/127 (29%)
C2H2 Zn finger 239..260 CDD:275368 6/20 (30%)
C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
zf-H2C2_2 280..305 CDD:290200 13/24 (54%)
zf-C2H2 294..316 CDD:278523 10/21 (48%)
C2H2 Zn finger 296..316 CDD:275368 9/19 (47%)
zf-H2C2_2 308..331 CDD:290200 9/22 (41%)
C2H2 Zn finger 324..344 CDD:275368 5/19 (26%)
C2H2 Zn finger 352..372 CDD:275368 7/19 (37%)
C2H2 Zn finger 416..436 CDD:275368
C2H2 Zn finger 443..464 CDD:275368
C2H2 Zn finger 470..490 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.