DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and CG10959

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster


Alignment Length:388 Identity:89/388 - (22%)
Similarity:141/388 - (36%) Gaps:139/388 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 NRLCASCQTCLQQAISFRERCLEVQRELLHSQDDEDFLRIC-------QESP--KSVLEQEELEL 104
            ||....|..|..:...|                 |||.|..       |..|  |:|       .
  Fly    34 NRFQLVCLLCDMKHFGF-----------------EDFARHIRNVHFDKQGRPLTKTV-------T 74

  Fly   105 DLAEISIEVERLDDLNEGPIQSSGFKV-----EDILNESK-------INEDEPN--------NED 149
            .|..::.|.:....::..|:....||.     ||:|:|.:       :.:||.|        .:.
  Fly    75 GLGRLAREEQEFQGVSAEPLAVDSFKKEYLPNEDVLSEEEDAEQELGLEQDEGNPLRIMVLGGKQ 139

  Fly   150 DIDYSEMDYLIYESDTE-----------------VDAKQELKSDSENPKKR---RNRRNPRDSNR 194
            .:|...:| .:::.|.:                 |:..|:.:.|.:..:.:   :.:|.|:|.| 
  Fly   140 SVDEETID-TMWQPDHDSSSASVNEGCALEALLGVENPQDYQPDEDGEEHQSVFKKQRQPKDYN- 202

  Fly   195 TFFCEEC----------GNHIKDRISF-----ILHCK----------RHRGVK--EFGCEFCEDR 232
               |..|          ..|:|....|     .:.||          :||..:  ||.|:.|:..
  Fly   203 ---CPHCDRRYTTQKYLNTHLKMSHPFPQAFKCVDCKATFDVDRALAQHRRKEHTEFACQLCDKV 264

  Fly   233 FCTPAELKRHIRKHTGEKPFKCRH--CSRSFSD-----------------------YSTRLK--- 269
            |.:...|.||::.|:|.:.|||.|  |.:||.:                       |.:|.:   
  Fly   265 FKSSRSLLRHVQGHSGARTFKCEHENCGKSFVNQHNLTSHRRVHSEERNYVCELCGYRSRYREAL 329

  Fly   270 --HERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSR----YTHLTTH 326
              |.||||.|:||.|:.|...|.:..:|..|..:|:.||.::||.||..|||    |.|...|
  Fly   330 IVHRRTHTGEKPFQCQTCARRFASKSLLNEHQAMHSTEKPYKCDKCDSAFSRPKALYHHKHLH 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871 5/27 (19%)
C2H2 Zn finger 198..218 CDD:275368 7/44 (16%)
COG5048 222..>276 CDD:227381 23/85 (27%)
C2H2 Zn finger 226..246 CDD:275368 6/19 (32%)
zf-H2C2_2 238..262 CDD:290200 11/25 (44%)
C2H2 Zn finger 254..274 CDD:275368 9/49 (18%)
zf-H2C2_2 269..291 CDD:290200 11/26 (42%)
C2H2 Zn finger 282..302 CDD:275368 5/19 (26%)
zf-H2C2_2 295..319 CDD:290200 10/23 (43%)
C2H2 Zn finger 310..328 CDD:275368 10/21 (48%)
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 4/20 (20%)
COG5048 <258..416 CDD:227381 43/135 (32%)
C2H2 Zn finger 258..278 CDD:275368 6/19 (32%)
C2H2 Zn finger 289..308 CDD:275368 3/18 (17%)
C2H2 Zn finger 316..336 CDD:275368 4/19 (21%)
zf-H2C2_2 328..353 CDD:290200 11/24 (46%)
C2H2 Zn finger 344..364 CDD:275368 5/19 (26%)
zf-H2C2_2 357..381 CDD:290200 10/23 (43%)
C2H2 Zn finger 372..392 CDD:275368 9/19 (47%)
C2H2 Zn finger 400..420 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.