DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and Zfp281

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001012030.1 Gene:Zfp281 / 305083 RGDID:1305139 Length:889 Species:Rattus norvegicus


Alignment Length:206 Identity:60/206 - (29%)
Similarity:90/206 - (43%) Gaps:37/206 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 IQSSGFKVEDILNESKINEDEPNNEDDIDYSEMDYLIYESDTEVDAKQELKSDSENPKKRRNRRN 188
            :.|||.:.:|..||      ||                :.||.|...:..|.:|:..|.   :|.
  Rat   191 LSSSGSRTDDHGNE------EP----------------KQDTNVKKAKRPKPESQGIKA---KRK 230

  Fly   189 PRDSNRTFFCEECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFK 253
            |..|::....|..|..:..            ..|...|:.|...|.:...|:||:..||||:||:
  Rat   231 PSASSKPLVGEGEGAVLSP------------SQKPHICDHCSAAFRSSYHLRRHVLIHTGERPFQ 283

  Fly   254 CRHCSRSFSDYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFS 318
            |..||..|.......:||:.|:.|:||.|.:|:..|...|.::.|...|:|||.::||.|.:.||
  Rat   284 CSQCSMGFIQKYLLQRHEKIHSREKPFGCDQCSMKFIQKYHMERHKRTHSGEKPYKCDTCQQYFS 348

  Fly   319 RYTHLTTHYRS 329
            |...|..|.|:
  Rat   349 RTDRLLKHRRT 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 2/19 (11%)
COG5048 222..>276 CDD:227381 20/53 (38%)
C2H2 Zn finger 226..246 CDD:275368 6/19 (32%)
zf-H2C2_2 238..262 CDD:290200 12/23 (52%)
C2H2 Zn finger 254..274 CDD:275368 6/19 (32%)
zf-H2C2_2 269..291 CDD:290200 9/21 (43%)
C2H2 Zn finger 282..302 CDD:275368 5/19 (26%)
zf-H2C2_2 295..319 CDD:290200 9/23 (39%)
C2H2 Zn finger 310..328 CDD:275368 8/17 (47%)
Zfp281NP_001012030.1 zf-C2H2_4 254..276 CDD:404733 6/21 (29%)
C2H2 Zn finger 256..276 CDD:275368 6/19 (32%)
zf-H2C2_2 268..293 CDD:404364 13/24 (54%)
C2H2 Zn finger 284..304 CDD:275368 6/19 (32%)
C2H2 Zn finger 312..332 CDD:275368 5/19 (26%)
zf-H2C2_2 324..349 CDD:404364 9/24 (38%)
C2H2 Zn finger 340..359 CDD:275368 8/18 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.