Sequence 1: | NP_649824.1 | Gene: | ranshi / 41041 | FlyBaseID: | FBgn0037620 | Length: | 346 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001012030.1 | Gene: | Zfp281 / 305083 | RGDID: | 1305139 | Length: | 889 | Species: | Rattus norvegicus |
Alignment Length: | 206 | Identity: | 60/206 - (29%) |
---|---|---|---|
Similarity: | 90/206 - (43%) | Gaps: | 37/206 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 124 IQSSGFKVEDILNESKINEDEPNNEDDIDYSEMDYLIYESDTEVDAKQELKSDSENPKKRRNRRN 188
Fly 189 PRDSNRTFFCEECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFK 253
Fly 254 CRHCSRSFSDYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFS 318
Fly 319 RYTHLTTHYRS 329 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ranshi | NP_649824.1 | zf-AD | 5..77 | CDD:214871 | |
C2H2 Zn finger | 198..218 | CDD:275368 | 2/19 (11%) | ||
COG5048 | 222..>276 | CDD:227381 | 20/53 (38%) | ||
C2H2 Zn finger | 226..246 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 238..262 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 254..274 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 269..291 | CDD:290200 | 9/21 (43%) | ||
C2H2 Zn finger | 282..302 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 295..319 | CDD:290200 | 9/23 (39%) | ||
C2H2 Zn finger | 310..328 | CDD:275368 | 8/17 (47%) | ||
Zfp281 | NP_001012030.1 | zf-C2H2_4 | 254..276 | CDD:404733 | 6/21 (29%) |
C2H2 Zn finger | 256..276 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 268..293 | CDD:404364 | 13/24 (54%) | ||
C2H2 Zn finger | 284..304 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 312..332 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 324..349 | CDD:404364 | 9/24 (38%) | ||
C2H2 Zn finger | 340..359 | CDD:275368 | 8/18 (44%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |