DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ranshi and Zfp316

DIOPT Version :9

Sequence 1:	NP_649824.1	Gene:	ranshi / 41041	FlyBaseID:	FBgn0037620	Length:	346	Species:	Drosophila melanogaster
Sequence 2:	NP_001100591.1	Gene:	Zfp316 / 304293	RGDID:	1311647	Length:	1016	Species:	Rattus norvegicus

Alignment Length:	140	Identity:	56/140 - (40%)
Similarity:	71/140 - (50%)	Gaps:	2/140 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   194 RTFFCEECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCS 258
            |.:.|.|||.......:...|...|...|...|..|...|...::.|||.|.|||||||:|..|.
  Rat   815 RPYACAECGRRFGQSAALTRHQWAHAEEKPHRCPDCGKGFGHSSDFKRHRRTHTGEKPFRCADCG 879

  Fly   259 RSFSDYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHL 323
            |.|:..|...||.|.||.||||.|.||...|:...:|..|...||||:.:.|..|.:.||:.:||
  Rat   880 RGFAQRSNLAKHRRGHTGERPFPCPECGKRFSQRSVLVTHQRTHTGERPYLCSNCGRRFSQSSHL 944

  Fly   324 TTHYRSNAHR 333
            .||.::  ||
  Rat   945 LTHMKT--HR 952

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ranshi	NP_649824.1	zf-AD	5..77	CDD:214871
		C2H2 Zn finger	198..218	CDD:275368	5/19 (26%)
		COG5048	222..>276	CDD:227381	24/53 (45%)
		C2H2 Zn finger	226..246	CDD:275368	7/19 (37%)
		zf-H2C2_2	238..262	CDD:290200	14/23 (61%)
		C2H2 Zn finger	254..274	CDD:275368	8/19 (42%)
		zf-H2C2_2	269..291	CDD:290200	13/21 (62%)
		C2H2 Zn finger	282..302	CDD:275368	6/19 (32%)
		zf-H2C2_2	295..319	CDD:290200	9/23 (39%)
		C2H2 Zn finger	310..328	CDD:275368	8/17 (47%)
Zfp316	NP_001100591.1	KRAB	151..211	CDD:214630
		KRAB	151..190	CDD:279668
		COG5048	<335..495	CDD:227381
		C2H2 Zn finger	339..359	CDD:275368
		C2H2 Zn finger	367..387	CDD:275368
		zf-C2H2	367..387	CDD:278523
		zf-H2C2_2	379..404	CDD:290200
		C2H2 Zn finger	395..415	CDD:275368
		zf-H2C2_2	407..432	CDD:290200
		C2H2 Zn finger	423..443	CDD:275368
		zf-H2C2_2	435..460	CDD:290200
		C2H2 Zn finger	451..471	CDD:275368
		zf-H2C2_2	463..486	CDD:290200
		C2H2 Zn finger	479..497	CDD:275368
		C2H2 Zn finger	707..727	CDD:275368
		zf-H2C2_2	719..744	CDD:290200
		C2H2 Zn finger	735..755	CDD:275368
		zf-H2C2_2	747..772	CDD:290200
		COG5048	<760..947	CDD:227381	52/131 (40%)
		C2H2 Zn finger	763..783	CDD:275368
		zf-H2C2_2	775..800	CDD:290200
		C2H2 Zn finger	791..811	CDD:275368
		C2H2 Zn finger	819..839	CDD:275368	5/19 (26%)
		zf-C2H2	845..867	CDD:278523	7/21 (33%)
		C2H2 Zn finger	847..867	CDD:275368	7/19 (37%)
		zf-H2C2_2	859..884	CDD:290200	15/24 (63%)
		C2H2 Zn finger	875..895	CDD:275368	8/19 (42%)
		zf-H2C2_2	887..912	CDD:290200	13/24 (54%)
		C2H2 Zn finger	903..923	CDD:275368	6/19 (32%)
		zf-H2C2_2	916..940	CDD:290200	9/23 (39%)
		C2H2 Zn finger	931..951	CDD:275368	8/21 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910