DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and ace2

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_594109.1 Gene:ace2 / 2541661 PomBaseID:SPAC6G10.12c Length:533 Species:Schizosaccharomyces pombe


Alignment Length:257 Identity:57/257 - (22%)
Similarity:95/257 - (36%) Gaps:69/257 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 LEVQRELLHSQDDEDFLRICQESPKSVLEQEELELDLAEISIEVERLDDLNEGPIQSSGFKVEDI 134
            |:|.|   |:.:.:.|.::  .||             ||...|.|:...:.:..:..|...:.:.
pombe   303 LDVCR---HTDNQKAFAKL--SSP-------------AEYVSEFEKFSSVCDHGLDISNANINNT 349

  Fly   135 LN---------ESKINEDEPNNEDDIDYSEMDYL---IYESD-------TEVDAKQELKSDSENP 180
            |.         ||.|...:|  |..|...|.:.|   |..:|       ||.|:|..::...::.
pombe   350 LTQQFALSAPYESCIVTKKP--EPCITVKEEEQLAPKIESADLSITPQVTEHDSKPPVRISYDHR 412

  Fly   181 KKRRNR-----RNPRDSNRTFFC--EECGNHIKDRISFILHCKRHRGVKEFGCEF--CEDRFCTP 236
            .|.|.:     |.|.::..:.:|  |..|.::                    |.:  |..|....
pombe   413 CKTRKQSTRICRIPPETMASLYCGPEADGKYV--------------------CLYNGCNKRIARK 457

  Fly   237 AELKRHIRKHTGEKPFKCRHCSRSFSDYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNH 298
            ..::.||:.|..::|::|..|...|..:....:|.|.|.|.||:|| ||...|.....|..|
pombe   458 YNVESHIQTHLSDRPYRCDLCKAGFVRHHDLKRHLRIHENGRPYVC-ECLKRFNRLDALNRH 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871 3/6 (50%)
C2H2 Zn finger 198..218 CDD:275368 3/21 (14%)
COG5048 222..>276 CDD:227381 13/55 (24%)
C2H2 Zn finger 226..246 CDD:275368 5/21 (24%)
zf-H2C2_2 238..262 CDD:290200 6/23 (26%)
C2H2 Zn finger 254..274 CDD:275368 5/19 (26%)
zf-H2C2_2 269..291 CDD:290200 11/21 (52%)
C2H2 Zn finger 282..302 CDD:275368 6/17 (35%)
zf-H2C2_2 295..319 CDD:290200 2/4 (50%)
C2H2 Zn finger 310..328 CDD:275368
ace2NP_594109.1 COG5048 45..518 CDD:227381 56/255 (22%)
C2H2 Zn finger 448..467 CDD:275368 4/18 (22%)
zf-C2H2 473..495 CDD:278523 5/21 (24%)
C2H2 Zn finger 475..495 CDD:275368 5/19 (26%)
zf-H2C2_2 487..511 CDD:290200 11/24 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.