DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and Zbtb16

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001028496.1 Gene:Zbtb16 / 235320 MGIID:103222 Length:673 Species:Mus musculus


Alignment Length:146 Identity:53/146 - (36%)
Similarity:76/146 - (52%) Gaps:4/146 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 NRRNPRDSNRTFFCEECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGE 249
            :|:....::...||..||...:.:.:...|.:.|.||:.:.|..|...|.:...||||:|.|||:
Mouse   479 HRQTHTGTDMAVFCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSHTGD 543

  Fly   250 KPFKCRHCSRSFSDYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCD 314
            .|::|..|...|.|.||...|:|.||.|:|:.|..|...|:..:.|:.|..||||||.|.|.||.
Mouse   544 HPYECEFCGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEKPFECKLCH 608

  Fly   315 KLFSRYT----HLTTH 326
            :....|:    ||.||
Mouse   609 QRSRDYSAMIKHLRTH 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 4/19 (21%)
COG5048 222..>276 CDD:227381 21/53 (40%)
C2H2 Zn finger 226..246 CDD:275368 8/19 (42%)
zf-H2C2_2 238..262 CDD:290200 11/23 (48%)
C2H2 Zn finger 254..274 CDD:275368 8/19 (42%)
zf-H2C2_2 269..291 CDD:290200 9/21 (43%)
C2H2 Zn finger 282..302 CDD:275368 5/19 (26%)
zf-H2C2_2 295..319 CDD:290200 12/23 (52%)
C2H2 Zn finger 310..328 CDD:275368 8/21 (38%)
Zbtb16NP_001028496.1 BTB_POZ_ZBTB16_PLZF 16..122 CDD:349514
C2H2 Zn finger 406..426 CDD:275368
C2H2 Zn finger 434..454 CDD:275368
COG5048 <448..622 CDD:227381 50/142 (35%)
C2H2 Zn finger 463..483 CDD:275368 1/3 (33%)
C2H2 Zn finger 492..512 CDD:275368 4/19 (21%)
C2H2 Zn finger 520..540 CDD:275368 8/19 (42%)
C2H2 Zn finger 548..568 CDD:275368 8/19 (42%)
C2H2 Zn finger 576..596 CDD:275368 5/19 (26%)
C2H2 Zn finger 604..624 CDD:275368 6/19 (32%)
C2H2 Zn finger 632..652 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.