DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and Zfp768

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_666314.1 Gene:Zfp768 / 233890 MGIID:2384582 Length:568 Species:Mus musculus


Alignment Length:141 Identity:53/141 - (37%)
Similarity:81/141 - (57%) Gaps:0/141 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 RTFFCEECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCS 258
            :.:.||.|..........|.|.:.|.|.:.:.|..|...|...:.|.||.|.|:|:||:||.||.
Mouse   315 KPYKCEVCSKAFSQSSDLIKHQRTHTGERPYKCPRCGKAFADSSYLLRHQRTHSGQKPYKCPHCG 379

  Fly   259 RSFSDYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHL 323
            ::|.|.|..|:|:|||::|||:.|.||...::.:..|::|..||||::.|.|.:|.|.||:.:.|
Mouse   380 KAFGDSSYLLRHQRTHSHERPYSCPECGKCYSQNSSLRSHQRVHTGQRPFSCGICGKSFSQRSAL 444

  Fly   324 TTHYRSNAHRR 334
            ..|.||:|..:
Mouse   445 IPHARSHAREK 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 5/19 (26%)
COG5048 222..>276 CDD:227381 23/53 (43%)
C2H2 Zn finger 226..246 CDD:275368 7/19 (37%)
zf-H2C2_2 238..262 CDD:290200 12/23 (52%)
C2H2 Zn finger 254..274 CDD:275368 9/19 (47%)
zf-H2C2_2 269..291 CDD:290200 10/21 (48%)
C2H2 Zn finger 282..302 CDD:275368 5/19 (26%)
zf-H2C2_2 295..319 CDD:290200 11/23 (48%)
C2H2 Zn finger 310..328 CDD:275368 7/17 (41%)
Zfp768NP_666314.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..223
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 228..247
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 264..287
C2H2 Zn finger 291..311 CDD:275368
zf-H2C2_2 304..328 CDD:290200 3/12 (25%)
C2H2 Zn finger 319..339 CDD:275368 5/19 (26%)
COG5048 <327..532 CDD:227381 50/129 (39%)
zf-H2C2_2 331..355 CDD:290200 6/23 (26%)
C2H2 Zn finger 347..367 CDD:275368 7/19 (37%)
zf-H2C2_2 359..382 CDD:290200 12/22 (55%)
zf-C2H2 373..395 CDD:278523 10/21 (48%)
C2H2 Zn finger 375..395 CDD:275368 9/19 (47%)
zf-C2H2 401..423 CDD:278523 5/21 (24%)
C2H2 Zn finger 403..423 CDD:275368 5/19 (26%)
zf-H2C2_2 415..440 CDD:290200 11/24 (46%)
C2H2 Zn finger 431..451 CDD:275368 8/19 (42%)
zf-H2C2_2 447..466 CDD:290200 4/9 (44%)
C2H2 Zn finger 459..479 CDD:275368
zf-C2H2 485..507 CDD:278523
C2H2 Zn finger 487..507 CDD:275368
zf-H2C2_2 500..522 CDD:290200
C2H2 Zn finger 515..535 CDD:275368
zf-H2C2_2 528..552 CDD:290200
zf-C2H2 541..563 CDD:278523
C2H2 Zn finger 543..563 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.