DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ranshi and Zfp341

DIOPT Version :9

Sequence 1:	NP_649824.1	Gene:	ranshi / 41041	FlyBaseID:	FBgn0037620	Length:	346	Species:	Drosophila melanogaster
Sequence 2:	NP_955008.2	Gene:	Zfp341 / 228807	MGIID:	2682937	Length:	846	Species:	Mus musculus

Alignment Length:	181	Identity:	52/181 - (28%)
Similarity:	74/181 - (40%)	Gaps:	33/181 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   186 RRNPRDSNRTFFCEECGN----------HIKDRI-SF-------ILHCKR--------HRGVKEF 224
            :.:|:..:..:.|.:|.|          |::... ||       :..|:|        |.....|
Mouse   527 QHSPKKDSTVYKCVKCVNKYSTPEALEHHVQTATHSFPCPHCQKVFPCERYLRRHLPTHGSGGRF 591

  Fly   225 GCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFSDYSTRLKHERTHTNERPFVC-----KE 284
            .|:.|:..|.....||.|...|:||||:||..|..:|:......:|...|...:.:.|     ..
Mouse   592 RCQICKKFFRKEHYLKLHAHIHSGEKPYKCSVCESAFNRKDKLKRHMLIHEPFKKYKCPFSMHTG 656

  Fly   285 CNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHYRSNAHRRN 335
            |:..|.....||.|:|.|.|.|..:|.||.|.|||..||..|.|  ||..|
Mouse   657 CSKEFNRQDKLKAHILSHAGLKLHKCGLCSKSFSRRAHLAEHQR--AHTGN 705

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ranshi	NP_649824.1	zf-AD	5..77	CDD:214871
		C2H2 Zn finger	198..218	CDD:275368	8/45 (18%)
		COG5048	222..>276	CDD:227381	18/53 (34%)
		C2H2 Zn finger	226..246	CDD:275368	6/19 (32%)
		zf-H2C2_2	238..262	CDD:290200	11/23 (48%)
		C2H2 Zn finger	254..274	CDD:275368	4/19 (21%)
		zf-H2C2_2	269..291	CDD:290200	5/26 (19%)
		C2H2 Zn finger	282..302	CDD:275368	7/24 (29%)
		zf-H2C2_2	295..319	CDD:290200	12/23 (52%)
		C2H2 Zn finger	310..328	CDD:275368	10/17 (59%)
Zfp341	NP_955008.2	COG5048	321..726	CDD:227381	52/181 (29%)
		zf-C2H2	321..342	CDD:278523
		C2H2 Zn finger	322..342	CDD:275368
		zf-H2C2_2	334..359	CDD:290200
		C2H2 Zn finger	350..370	CDD:275368
		C2H2 Zn finger	444..464	CDD:275368
		C2H2 Zn finger	472..494	CDD:275368
		C2H2 Zn finger	502..522	CDD:275368
		C2H2 Zn finger	539..561	CDD:275370	4/21 (19%)
		C2H2 Zn finger	565..585	CDD:275368	2/19 (11%)
		C2H2 Zn finger	593..613	CDD:275368	6/19 (32%)
		zf-H2C2_2	605..630	CDD:290200	12/24 (50%)
		C2H2 Zn finger	621..641	CDD:275368	4/19 (21%)
		C2H2 Zn finger	649..674	CDD:275368	7/24 (29%)
		C2H2 Zn finger	682..702	CDD:275368	11/21 (52%)
		C2H2 Zn finger	710..727	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167836415
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930