| Sequence 1: | NP_649824.1 | Gene: | ranshi / 41041 | FlyBaseID: | FBgn0037620 | Length: | 346 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_689908.3 | Gene: | ZNF449 / 203523 | HGNCID: | 21039 | Length: | 518 | Species: | Homo sapiens |
| Alignment Length: | 422 | Identity: | 97/422 - (22%) |
|---|---|---|---|
| Similarity: | 149/422 - (35%) | Gaps: | 145/422 - (34%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 49 NRLCASCQTCLQQAISFRERCLEVQRELLHSQDDEDFLRI------------CQESPKSVLE--- 98
Fly 99 --QEELELDLAEISIEVERLDDL-------------------------NEGPIQSS--------- 127
Fly 128 ---------------GFKVEDI-LNESKINEDEP--------------------------NNEDD 150
Fly 151 IDYSEM----------------------DYLIYESDTEV---DAKQELKS--DSENP-------- 180
Fly 181 --------KKRRNRRNPRDSNRTFFCEECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPA 237
Fly 238 ELKRHIRKHTGEKPFKCRHCSRSFSDYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVH 302
Fly 303 TGEKAFRCDLCDKLFSRYTHLTTHYRSNAHRR 334 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ranshi | NP_649824.1 | zf-AD | 5..77 | CDD:214871 | 7/27 (26%) |
| C2H2 Zn finger | 198..218 | CDD:275368 | 4/19 (21%) | ||
| COG5048 | 222..>276 | CDD:227381 | 21/53 (40%) | ||
| C2H2 Zn finger | 226..246 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 238..262 | CDD:290200 | 11/23 (48%) | ||
| C2H2 Zn finger | 254..274 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 269..291 | CDD:290200 | 9/21 (43%) | ||
| C2H2 Zn finger | 282..302 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 295..319 | CDD:290200 | 13/23 (57%) | ||
| C2H2 Zn finger | 310..328 | CDD:275368 | 10/17 (59%) | ||
| ZNF449 | NP_689908.3 | SCAN | 27..134 | CDD:322011 | 21/91 (23%) |
| SFP1 | <235..402 | CDD:227516 | 39/168 (23%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 292..325 | 4/34 (12%) | |||
| COG5048 | <321..483 | CDD:227381 | 53/141 (38%) | ||
| C2H2 Zn finger | 325..345 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 353..373 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 381..401 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 409..429 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 437..457 | CDD:275368 | 11/19 (58%) | ||
| C2H2 Zn finger | 465..485 | CDD:275368 | |||
| zf-H2C2_2 | 477..502 | CDD:316026 | |||
| C2H2 Zn finger | 493..513 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||