| Sequence 1: | NP_649824.1 | Gene: | ranshi / 41041 | FlyBaseID: | FBgn0037620 | Length: | 346 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001360749.1 | Gene: | F47E1.20 / 185936 | WormBaseID: | WBGene00304808 | Length: | 322 | Species: | Caenorhabditis elegans |
| Alignment Length: | 210 | Identity: | 66/210 - (31%) |
|---|---|---|---|
| Similarity: | 95/210 - (45%) | Gaps: | 41/210 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 144 EPNNEDDIDYSEM--------DYLIYESDTEVDAKQELKSDSENP-------KKRRNRRNPRDSN 193
Fly 194 RTFFCEECG-----NHIKDRISFILHCKRHR----GVKEFGCEFCEDRFCTPAELKRHI-RKHTG 248
Fly 249 EKPFKCRHCSRSFSDYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLC 313
Fly 314 DKLFSRYTHLTTHYR 328 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ranshi | NP_649824.1 | zf-AD | 5..77 | CDD:214871 | |
| C2H2 Zn finger | 198..218 | CDD:275368 | 7/24 (29%) | ||
| COG5048 | 222..>276 | CDD:227381 | 19/54 (35%) | ||
| C2H2 Zn finger | 226..246 | CDD:275368 | 6/20 (30%) | ||
| zf-H2C2_2 | 238..262 | CDD:290200 | 8/24 (33%) | ||
| C2H2 Zn finger | 254..274 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 269..291 | CDD:290200 | 11/21 (52%) | ||
| C2H2 Zn finger | 282..302 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 295..319 | CDD:290200 | 11/23 (48%) | ||
| C2H2 Zn finger | 310..328 | CDD:275368 | 5/17 (29%) | ||
| F47E1.20 | NP_001360749.1 | SFP1 | <123..290 | CDD:227516 | 54/182 (30%) |
| C2H2 Zn finger | 180..204 | CDD:275368 | 8/28 (29%) | ||
| C2H2 Zn finger | 212..231 | CDD:275368 | 6/18 (33%) | ||
| C2H2 Zn finger | 241..261 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 253..277 | CDD:372612 | 10/23 (43%) | ||
| C2H2 Zn finger | 269..289 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 282..306 | CDD:372612 | 11/23 (48%) | ||
| C2H2 Zn finger | 297..315 | CDD:275368 | 5/17 (29%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 120 | 1.000 | Inparanoid score | I3338 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.050 | |||||