DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ranshi and ztf-28

DIOPT Version :9

Sequence 1:	NP_649824.1	Gene:	ranshi / 41041	FlyBaseID:	FBgn0037620	Length:	346	Species:	Drosophila melanogaster
Sequence 2:	NP_503566.1	Gene:	ztf-28 / 185364	WormBaseID:	WBGene00018099	Length:	272	Species:	Caenorhabditis elegans

Alignment Length:	126	Identity:	32/126 - (25%)
Similarity:	52/126 - (41%)	Gaps:	14/126 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly   151 IDYSEMDYLIYESDTEVDAKQELKSDSENPKKRRNRRNPRDSNRTFFCEECGNHIKDRISFILHC 215
            :|.|:...||...:||...|..|....|:..||.:.|.      .|.|..||.:.|...|.
Worm     1 MDTSDHKPLIDRFETEFAEKSSLLRKEESELKRPDLRG------DFLCLSCGQNFKHGASL---- 55

  Fly   216 KRHRGV---KEFGCEFCEDRFCTPAELKRHIR-KHTGEKPFKCRHCSRSFSDYSTRLKHER 272
            .|||.:   .|:.|..|..:......::.|:| :|...:.:.|..|:.:||:.....:|.:
Worm    56 NRHRKLVHSDEYTCMLCARKLYLKETVRDHMRNEHYLGQVYTCGCCNWTFSNKKALTEHAK 116

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ranshi	NP_649824.1	zf-AD	5..77	CDD:214871
		C2H2 Zn finger	198..218	CDD:275368	5/19 (26%)
		COG5048	222..>276	CDD:227381	11/52 (21%)
		C2H2 Zn finger	226..246	CDD:275368	4/20 (20%)
		zf-H2C2_2	238..262	CDD:290200	5/24 (21%)
		C2H2 Zn finger	254..274	CDD:275368	5/19 (26%)
		zf-H2C2_2	269..291	CDD:290200	1/4 (25%)
		C2H2 Zn finger	282..302	CDD:275368
		zf-H2C2_2	295..319	CDD:290200
		C2H2 Zn finger	310..328	CDD:275368
ztf-28	NP_503566.1	COG5236	<14..>114	CDD:227561	27/109 (25%)
		C2H2 Zn finger	42..63	CDD:275368	8/24 (33%)
		C2H2 Zn finger	69..90	CDD:275368	4/20 (20%)
		C2H2 Zn finger	98..114	CDD:275368	4/15 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	1	1.000	-	-
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.000