DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and ztf-30

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_498892.1 Gene:ztf-30 / 182317 WormBaseID:WBGene00015523 Length:397 Species:Caenorhabditis elegans


Alignment Length:170 Identity:37/170 - (21%)
Similarity:56/170 - (32%) Gaps:43/170 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 LNESKINEDEPNNEDDIDYSEMDYLIYESDTEVDAKQELKSDSENPKKRRNRRNPRDSNRTFFCE 199
            |.:.||:  .|.|.::..|.        ||.||:...::............|.:.:.|       
 Worm     3 LEDDKIH--SPTNTEEEGYG--------SDVEVENGTDISGSKGGSGVELKRPDLKGS------- 50

  Fly   200 ECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFSDY 264
                                    |.|..|...||..:.|.|| |.....|.:||..|.:..|..
 Worm    51 ------------------------FRCSICSKVFCHSSSLSRH-RMQAHFKSYKCTVCRKDISSS 90

  Fly   265 STRLKHE-RTHTNERPFVCKECNNAFTTSYILKNHMLVHT 303
            .:...|. :.|...|.::|:.||.||....:|..|:...|
 Worm    91 ESLRTHMFKQHHISRMYMCRCCNWAFPDKSLLHIHLQTAT 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 0/19 (0%)
COG5048 222..>276 CDD:227381 16/54 (30%)
C2H2 Zn finger 226..246 CDD:275368 8/19 (42%)
zf-H2C2_2 238..262 CDD:290200 8/23 (35%)
C2H2 Zn finger 254..274 CDD:275368 4/20 (20%)
zf-H2C2_2 269..291 CDD:290200 8/22 (36%)
C2H2 Zn finger 282..302 CDD:275368 7/19 (37%)
zf-H2C2_2 295..319 CDD:290200 3/9 (33%)
C2H2 Zn finger 310..328 CDD:275368
ztf-30NP_498892.1 PHA00733 <51..103 CDD:177301 16/52 (31%)
C2H2 Zn finger 53..74 CDD:275368 8/21 (38%)
C2H2 Zn finger 80..101 CDD:275368 4/20 (20%)
C2H2 Zn finger 109..128 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.