DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ranshi and ztf-25

DIOPT Version :9

Sequence 1:	NP_649824.1	Gene:	ranshi / 41041	FlyBaseID:	FBgn0037620	Length:	346	Species:	Drosophila melanogaster
Sequence 2:	NP_507456.1	Gene:	ztf-25 / 180158	WormBaseID:	WBGene00012405	Length:	244	Species:	Caenorhabditis elegans

Alignment Length:	143	Identity:	38/143 - (26%)
Similarity:	54/143 - (37%)	Gaps:	21/143 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly   179 NP--KKRRNRRNPRDSNRTFFCEECGNHIKDRISFILHCKRHRGV---KEFGCEFCEDRFCTPAE 238
            ||  :|..:.....|....|.|..||.|.:...|.    .|||.:   .|..|..|:.:......
Worm     6 NPVIRKEYSELKRPDLRGKFICASCGQHFQHNASL----NRHRRLLHGNEHTCMMCDRKLNAKET 66

  Fly   239 LKRHIR-KHTGEKPFKCRHCSRSFSDYSTRLKHERTH-------TNERPFVCKECN--NAFTTSY 293
            ::.|:| :|...:.|.|..|:.|||  |.|...|.|.       ..:...:.|.||  .:...|.
Worm    67 IRDHMRNEHNLFQVFTCGCCNWSFS--SKRQLSEHTKCIQGTGAPGDTIPIAKSCNAPGSLIQST 129

  Fly   294 ILKNHMLVHTGEK 306
            |.....:|.||.|
Worm   130 IQGTPPVVKTGRK 142

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ranshi	NP_649824.1	zf-AD	5..77	CDD:214871
		C2H2 Zn finger	198..218	CDD:275368	5/19 (26%)
		COG5048	222..>276	CDD:227381	16/61 (26%)
		C2H2 Zn finger	226..246	CDD:275368	4/20 (20%)
		zf-H2C2_2	238..262	CDD:290200	7/24 (29%)
		C2H2 Zn finger	254..274	CDD:275368	8/19 (42%)
		zf-H2C2_2	269..291	CDD:290200	5/30 (17%)
		C2H2 Zn finger	282..302	CDD:275368	5/21 (24%)
		zf-H2C2_2	295..319	CDD:290200	4/12 (33%)
		C2H2 Zn finger	310..328	CDD:275368
ztf-25	NP_507456.1	COG5236	<22..>122	CDD:227561	28/105 (27%)
		C2H2 Zn finger	27..48	CDD:275368	8/24 (33%)
		C2H2 Zn finger	54..75	CDD:275368	4/20 (20%)
		C2H2 Zn finger	83..102	CDD:275368	9/20 (45%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	1	1.000	-	-
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.000