DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ranshi and lsy-27

DIOPT Version :9

Sequence 1:	NP_649824.1	Gene:	ranshi / 41041	FlyBaseID:	FBgn0037620	Length:	346	Species:	Drosophila melanogaster
Sequence 2:	NP_001256739.1	Gene:	lsy-27 / 180149	WormBaseID:	WBGene00009834	Length:	250	Species:	Caenorhabditis elegans

Alignment Length:	92	Identity:	28/92 - (30%)
Similarity:	42/92 - (45%)	Gaps:	10/92 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   238 ELKR-HIRKHTGEKPFKCRHCSRSFSDYSTRLKHER-THTNERPFVCKECNNAFTTSYILKNHML 300
            |||| .:|   |:  |.|..||::|...::..:|.: .|:||.  .|..|..|......::.||.
Worm    15 ELKRPDLR---GK--FVCSSCSQNFQHSASLNRHRQLMHSNEH--TCMMCERALNQKETIREHMR 72

  Fly   301 -VHTGEKAFRCDLCDKLFSRYTHLTTH 326
             .|...:.|.|..|:..|:....||.|
Worm    73 NEHNLAQVFTCGCCNWTFASKRQLTEH 99

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ranshi	NP_649824.1	zf-AD	5..77	CDD:214871
		C2H2 Zn finger	198..218	CDD:275368
		COG5048	222..>276	CDD:227381	13/39 (33%)
		C2H2 Zn finger	226..246	CDD:275368	5/8 (63%)
		zf-H2C2_2	238..262	CDD:290200	10/24 (42%)
		C2H2 Zn finger	254..274	CDD:275368	5/20 (25%)
		zf-H2C2_2	269..291	CDD:290200	7/22 (32%)
		C2H2 Zn finger	282..302	CDD:275368	5/20 (25%)
		zf-H2C2_2	295..319	CDD:290200	7/24 (29%)
		C2H2 Zn finger	310..328	CDD:275368	6/17 (35%)
lsy-27	NP_001256739.1	COG5236	<22..>122	CDD:227561	24/85 (28%)
		C2H2 Zn finger	27..48	CDD:275368	5/20 (25%)
		C2H2 Zn finger	54..75	CDD:275368	5/20 (25%)
		C2H2 Zn finger	83..102	CDD:275368	6/17 (35%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	1	1.000	-	-
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.000