DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and M03D4.4

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001023313.1 Gene:M03D4.4 / 177375 WormBaseID:WBGene00019751 Length:505 Species:Caenorhabditis elegans


Alignment Length:190 Identity:54/190 - (28%)
Similarity:85/190 - (44%) Gaps:9/190 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 NEDEPNNEDDIDYSEMDYL-IYESD--TEVDAKQELKSDSENPKKRRNRRNPRDSNRTFFCEECG 202
            :::|...|||.|...|..: |.:||  ::.|:.|.    |.||.....:.:..:..| :.||:|.
 Worm    35 DQEEDRMEDDSDELAMIKIKIEDSDFLSDTDSSQL----SMNPTTPSEKSSSGEKGR-YECEDCH 94

  Fly   203 NHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFSDYSTR 267
            .....:.....|.:.|.|.:...|..|...|.|...||:|...||||:...|.||:::|......
 Worm    95 EMFAVKRELATHMRIHSGEQPHSCTQCGKEFGTRQLLKKHWMWHTGERSHVCPHCNKAFFQKGHL 159

  Fly   268 LKHERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHY 327
            .:|...|:..||..|.:|:..|...:.|..||.:|. |:.|.|..|.:.|.:...|..|:
 Worm   160 TQHLMIHSGGRPHECPQCHKTFIFKFDLNRHMKIHQ-ERGFSCQQCGRSFLKQVMLDEHH 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 4/19 (21%)
COG5048 222..>276 CDD:227381 17/53 (32%)
C2H2 Zn finger 226..246 CDD:275368 7/19 (37%)
zf-H2C2_2 238..262 CDD:290200 10/23 (43%)
C2H2 Zn finger 254..274 CDD:275368 5/19 (26%)
zf-H2C2_2 269..291 CDD:290200 7/21 (33%)
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
zf-H2C2_2 295..319 CDD:290200 9/23 (39%)
C2H2 Zn finger 310..328 CDD:275368 5/18 (28%)
M03D4.4NP_001023313.1 C2H2 Zn finger 90..110 CDD:275368 4/19 (21%)
zf-H2C2_2 102..127 CDD:290200 6/24 (25%)
C2H2 Zn finger 118..138 CDD:275368 7/19 (37%)
C2H2 Zn finger 146..166 CDD:275368 5/19 (26%)
zf-H2C2_2 158..181 CDD:290200 6/22 (27%)
zf-C2H2 172..194 CDD:278523 6/21 (29%)
C2H2 Zn finger 174..194 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.