DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ranshi and blmp-1

DIOPT Version :9

Sequence 1:	NP_649824.1	Gene:	ranshi / 41041	FlyBaseID:	FBgn0037620	Length:	346	Species:	Drosophila melanogaster
Sequence 2:	NP_001251370.1	Gene:	blmp-1 / 172917	WormBaseID:	WBGene00003847	Length:	817	Species:	Caenorhabditis elegans

Alignment Length:	119	Identity:	46/119 - (38%)
Similarity:	70/119 - (58%)	Gaps:	0/119 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   216 KRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFSDYSTRLKHERTHTNERPF 280
            ::..|...:.|:.|...|...:.||.|:|.||||:||||..|::.|:..:...||...||.|||.
Worm   500 QQENGKTRYACKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHLVHTGERPH 564

  Fly   281 VCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHYRSNAHRR 334
            .|..|:..|:::..||.|:.:|.|:|.:.||:||..|::|.||..|.|.:|:.|
Worm   565 RCDICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHANER 618

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ranshi	NP_649824.1	zf-AD	5..77	CDD:214871
		C2H2 Zn finger	198..218	CDD:275368	0/1 (0%)
		COG5048	222..>276	CDD:227381	20/53 (38%)
		C2H2 Zn finger	226..246	CDD:275368	7/19 (37%)
		zf-H2C2_2	238..262	CDD:290200	13/23 (57%)
		C2H2 Zn finger	254..274	CDD:275368	5/19 (26%)
		zf-H2C2_2	269..291	CDD:290200	10/21 (48%)
		C2H2 Zn finger	282..302	CDD:275368	6/19 (32%)
		zf-H2C2_2	295..319	CDD:290200	11/23 (48%)
		C2H2 Zn finger	310..328	CDD:275368	9/17 (53%)
blmp-1	NP_001251370.1	SET	119..247	CDD:214614
		zf-C2H2	508..530	CDD:278523	7/21 (33%)
		C2H2 Zn finger	510..530	CDD:275368	7/19 (37%)
		zf-H2C2_2	522..547	CDD:290200	14/24 (58%)
		C2H2 Zn finger	538..558	CDD:275368	5/19 (26%)
		zf-H2C2_2	550..575	CDD:290200	10/24 (42%)
		C2H2 Zn finger	566..586	CDD:275368	6/19 (32%)
		zf-H2C2_2	578..603	CDD:290200	11/24 (46%)
		C2H2 Zn finger	594..614	CDD:275368	10/19 (53%)
		zf-H2C2_2	606..631	CDD:290200	6/13 (46%)
		ARS2	<620..772	CDD:282772
		C2H2 Zn finger	622..641	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000