DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and ZNF570

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001287922.1 Gene:ZNF570 / 148268 HGNCID:26416 Length:592 Species:Homo sapiens


Alignment Length:404 Identity:101/404 - (25%)
Similarity:158/404 - (39%) Gaps:118/404 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 QQAISFRE----------RCLE-VQRELLHSQDDEDF-----LRICQESPKSV--LEQ------- 99
            |:.::||:          .||: .||.|..:...|::     |.:|...|..:  |||       
Human    67 QELVTFRDVAVDFSQEEWDCLDSSQRHLYSNVMLENYRILVSLGLCFSKPSVILLLEQGKAPWMV 131

  Fly   100 -EELELDLA---EISIEVERLDDLNEGPIQSSGFKVEDILNE-----SKINED---------EPN 146
             .||...|.   |...|.|.|....:...:....|:.:.|..     |.:.|:         :|.
Human   132 KRELTKGLCSGWEPICETEELTPKQDFYEEHQSQKIIETLTSYNLEYSSLREEWKCEGYFERQPG 196

  Fly   147 NE-----DDI--------DYSEMDYLIYES-------DTEVDAKQELKSDSENPKKRRNRRN--- 188
            |:     ::|        |..|.:|..:.|       .|:....:|.|....:.:||..::|   
Human   197 NQKACFKEEIITHEEPLFDEREQEYKSWGSFHQNPLLCTQKIIPKEEKVHKHDTQKRSFKKNLMA 261

  Fly   189 --PR------------DSNRTFF-------------------CEECGNHIKDRISFILHCKRHRG 220
              |:            |..:.|.                   |.|||.....|.:.:.|.:.|.|
Human   262 IKPKSVCAEKKLLKCNDCEKVFSQSSSLTLHQRIHTGEKPYKCIECGKAFSQRSNLVQHQRIHTG 326

  Fly   221 VKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFSDYSTRLKHERTHTNERPFVCKEC 285
            .|.:.|:.|...|...|.|.:|:|.||||||::|:.|.::||.::...:|:|.||.|:|:.|.||
Human   327 EKPYECKECRKAFSQNAHLVQHLRVHTGEKPYECKVCRKAFSQFAYLAQHQRVHTGEKPYECIEC 391

  Fly   286 NNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHYR------------------SNAH 332
            ..||:....:..|..||||||.:.|::|.|.||...:||.|.|                  .|:|
Human   392 GKAFSNRSSIAQHQRVHTGEKPYECNVCGKAFSLRAYLTVHQRIHTGERPYECKECGKAFSQNSH 456

  Fly   333 RRNMQKADTIFDKP 346
            ....|:..| .:||
Human   457 LAQHQRIHT-GEKP 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871 7/27 (26%)
C2H2 Zn finger 198..218 CDD:275368 6/19 (32%)
COG5048 222..>276 CDD:227381 21/53 (40%)
C2H2 Zn finger 226..246 CDD:275368 7/19 (37%)
zf-H2C2_2 238..262 CDD:290200 11/23 (48%)
C2H2 Zn finger 254..274 CDD:275368 6/19 (32%)
zf-H2C2_2 269..291 CDD:290200 11/21 (52%)
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
zf-H2C2_2 295..319 CDD:290200 11/23 (48%)
C2H2 Zn finger 310..328 CDD:275368 8/17 (47%)
ZNF570NP_001287922.1 KRAB 70..130 CDD:214630 14/59 (24%)
C2H2 Zn finger 276..296 CDD:275368 2/19 (11%)
zf-H2C2_2 288..313 CDD:316026 4/24 (17%)
C2H2 Zn finger 304..324 CDD:275368 6/19 (32%)
COG5048 <307..572 CDD:227381 57/164 (35%)
C2H2 Zn finger 332..352 CDD:275368 7/19 (37%)
C2H2 Zn finger 360..380 CDD:275368 6/19 (32%)
C2H2 Zn finger 388..408 CDD:275368 6/19 (32%)
C2H2 Zn finger 416..436 CDD:275368 9/19 (47%)
C2H2 Zn finger 444..464 CDD:275368 3/19 (16%)
C2H2 Zn finger 472..492 CDD:275368
C2H2 Zn finger 500..520 CDD:275368
C2H2 Zn finger 528..548 CDD:275368
C2H2 Zn finger 556..576 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.