DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and ZNF563

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_660319.1 Gene:ZNF563 / 147837 HGNCID:30498 Length:476 Species:Homo sapiens


Alignment Length:357 Identity:91/357 - (25%)
Similarity:145/357 - (40%) Gaps:82/357 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 AISFRERCLEVQRE---LLHSQDDEDFLRICQESPKSVLEQEELELDLAEISIEVERLDDLNEGP 123
            |::|.:..:...:|   ||.......:..:.||:.::        ||...:..|.:..:|..:.|
Human     3 AVAFEDVAVNFTQEEWALLGPSQKNLYRYVMQETIRN--------LDCIRMIWEEQNTEDQYKNP 59

  Fly   124 IQSSGFKVEDILNESK-----------INEDEPNN-----EDDIDYSE-----MDYLIYESDTEV 167
            .::....:.:..:|||           |.:...||     ||....:|     |.:|...|...|
Human    60 RRNLRCHMVERFSESKDSSQCGETFSLIRDSIVNNSICPGEDPCQSAECEEVIMGHLSLNSHIRV 124

  Fly   168 DA---KQELKSDSENP---KKR----------RNRRNPRDSNRTFFCEECGNHIKDRISFILH-- 214
            |:   ..|.:...|.|   |:|          ::|..|....:.:.|:|||.....|.:...|  
Human   125 DSGHKPHEYQEYGEKPHTHKQRGKAFSYHHSFQSRGRPHTGKKRYECKECGKTFSSRRNLRRHMV 189

  Fly   215 ---------CK-----------------RHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFK 253
                     ||                 .|.|.|.:.|:.|...|...:..:||.|.||||||::
Human   190 VQGGNRPYKCKLCGKAFFWPSLLRMHERTHTGEKPYECKQCSKAFPFYSSYRRHERMHTGEKPYE 254

  Fly   254 CRHCSRSFSDYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLF- 317
            |:.||::..|.|:.::||||||.|:|:.||:|..||:.|..|:.|...|:.||.:.|..|.|.| 
Human   255 CKQCSKALPDSSSYIRHERTHTGEKPYTCKQCGKAFSVSSSLRRHETTHSAEKPYECKQCGKTFH 319

  Fly   318 ---SRYTHLTTHYRSNAHRRNMQKADTIFDKP 346
               |...|:..|.....|:..:  ....||:|
Human   320 HLGSFQIHMKRHTGDRPHKCKI--CGKGFDRP 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871 3/17 (18%)
C2H2 Zn finger 198..218 CDD:275368 8/47 (17%)
COG5048 222..>276 CDD:227381 23/53 (43%)
C2H2 Zn finger 226..246 CDD:275368 6/19 (32%)
zf-H2C2_2 238..262 CDD:290200 12/23 (52%)
C2H2 Zn finger 254..274 CDD:275368 8/19 (42%)
zf-H2C2_2 269..291 CDD:290200 13/21 (62%)
C2H2 Zn finger 282..302 CDD:275368 8/19 (42%)
zf-H2C2_2 295..319 CDD:290200 9/27 (33%)
C2H2 Zn finger 310..328 CDD:275368 7/21 (33%)
ZNF563NP_660319.1 KRAB 4..40 CDD:307490 6/43 (14%)
C2H2 Zn finger 147..163 CDD:275368 1/15 (7%)
C2H2 Zn finger 171..191 CDD:275368 6/19 (32%)
COG5048 194..>472 CDD:227381 52/158 (33%)
C2H2 Zn finger 199..219 CDD:275368 2/19 (11%)
C2H2 Zn finger 227..247 CDD:275368 6/19 (32%)
C2H2 Zn finger 255..275 CDD:275368 8/19 (42%)
C2H2 Zn finger 283..303 CDD:275368 8/19 (42%)
C2H2 Zn finger 311..331 CDD:275368 6/19 (32%)
C2H2 Zn finger 339..359 CDD:275368 3/13 (23%)
C2H2 Zn finger 367..387 CDD:275368
C2H2 Zn finger 395..415 CDD:275368
C2H2 Zn finger 423..443 CDD:275368
C2H2 Zn finger 451..471 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 0.118 Domainoid score I11437
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.