DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and ZNF784

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_976308.1 Gene:ZNF784 / 147808 HGNCID:33111 Length:323 Species:Homo sapiens


Alignment Length:174 Identity:53/174 - (30%)
Similarity:69/174 - (39%) Gaps:39/174 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 CEECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGE------------- 249
            |..||:......|...|...|.|.:.:.|..|...|...|.|.||..:|..|             
Human   103 CHVCGHSCPGPASLRAHYSLHTGERPYRCALCPRAFKALAPLLRHQHRHGVEPGTSRRPPDTAAV 167

  Fly   250 --------------------------KPFKCRHCSRSFSDYSTRLKHERTHTNERPFVCKECNNA 288
                                      |||.||.|::.|...|....|||.||.|||:.|..|...
Human   168 AEQRPGVAPERAEVVMAAAAAGAAVGKPFACRFCAKPFRRSSDMRDHERVHTGERPYHCGICGKG 232

  Fly   289 FTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHYRSNAH 332
            ||.|.:|..|..:||||:.|||.|||:.|:..::...|.|::.|
Human   233 FTQSSVLSGHARIHTGERPFRCTLCDRTFNNSSNFRKHQRTHFH 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 5/19 (26%)
COG5048 222..>276 CDD:227381 21/92 (23%)
C2H2 Zn finger 226..246 CDD:275368 7/19 (37%)
zf-H2C2_2 238..262 CDD:290200 11/62 (18%)
C2H2 Zn finger 254..274 CDD:275368 8/19 (42%)
zf-H2C2_2 269..291 CDD:290200 11/21 (52%)
C2H2 Zn finger 282..302 CDD:275368 7/19 (37%)
zf-H2C2_2 295..319 CDD:290200 13/23 (57%)
C2H2 Zn finger 310..328 CDD:275368 6/17 (35%)
ZNF784NP_976308.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
C2H2 Zn finger 67..87 CDD:275368
C2H2 Zn finger 103..123 CDD:275368 5/19 (26%)
C2H2 Zn finger 131..151 CDD:275368 7/19 (37%)
COG5048 <194..276 CDD:227381 36/81 (44%)
C2H2 Zn finger 198..218 CDD:275368 8/19 (42%)
C2H2 Zn finger 226..246 CDD:275368 7/19 (37%)
C2H2 Zn finger 254..274 CDD:275368 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 269..323 3/8 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4797
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.