DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and ZNF280A

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_542778.2 Gene:ZNF280A / 129025 HGNCID:18597 Length:542 Species:Homo sapiens


Alignment Length:232 Identity:59/232 - (25%)
Similarity:96/232 - (41%) Gaps:28/232 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 FKVEDILNESKINEDEPN--NEDDIDYSEMDYLIYESDTEVDAKQE----LKSDSENPKKRRNRR 187
            |...|...::..|..:|.  :|..:..:::..|..::.| .|.|:|    |.||....:.:.:.:
Human   226 FPWPDANGKAHFNLTDPERASESALAMTDISSLASQNKT-FDPKKENPIVLLSDFYYGQHKGDGQ 289

  Fly   188 NPRDSNRTFFCEECGNHIKDRISFILHCKRHRGVKEF------------GCEFCEDRFCTPAELK 240
            ..:.::.||.|..|...:|: |.|:.|.|.|   .||            .|:.|..:|.||.:|:
Human   290 PEQKTHTTFKCLSCVKVLKN-IKFMNHMKHH---LEFEKQRNDSWEDHTTCQHCHRQFPTPFQLQ 350

  Fly   241 RHIRK-HTGEKPFK-CRHCSRSFSDYSTRLKHERTH--TNERPFVCKECNNAFTTSYILKNHM-L 300
            .||.. |....|.. |:.|..||......|:|.:.|  ..|.|:||:.|:...:....::.|. .
Human   351 CHIDSVHIAMGPSAVCKICELSFETDQVLLQHMKDHHKPGEMPYVCQVCHYRSSVFADVETHFRT 415

  Fly   301 VHTGEKAFRCDLCDKLFSRYTHLTTHYRSNAHRRNMQ 337
            .|...|...|..|.|||........|...::.||.:|
Human   416 CHENTKNLLCLFCLKLFKTAIPYMNHCWRHSRRRVLQ 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 7/19 (37%)
COG5048 222..>276 CDD:227381 19/69 (28%)
C2H2 Zn finger 226..246 CDD:275368 8/20 (40%)
zf-H2C2_2 238..262 CDD:290200 8/25 (32%)
C2H2 Zn finger 254..274 CDD:275368 6/19 (32%)
zf-H2C2_2 269..291 CDD:290200 7/23 (30%)
C2H2 Zn finger 282..302 CDD:275368 3/20 (15%)
zf-H2C2_2 295..319 CDD:290200 8/24 (33%)
C2H2 Zn finger 310..328 CDD:275368 6/17 (35%)
ZNF280ANP_542778.2 DUF4195 47..217 CDD:316361
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 105..185
C2H2 Zn finger 336..357 CDD:275368 8/20 (40%)
C2H2 Zn finger 366..386 CDD:275368 6/19 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 502..542
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7951
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.