DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and AgaP_AGAP005978

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_556655.3 Gene:AgaP_AGAP005978 / 1276651 VectorBaseID:AGAP005978 Length:451 Species:Anopheles gambiae


Alignment Length:147 Identity:49/147 - (33%)
Similarity:80/147 - (54%) Gaps:2/147 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 RTFFCEECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCS 258
            :.:.|..||.....:.:.:.|...|.|:|.:.|..|:..|...|.:.:|...|:|.||:||..|.
Mosquito   299 KPYKCNTCGKAFAQQANMVKHEMLHTGIKPYKCSVCDKAFAQQANMVKHQMLHSGIKPYKCPTCD 363

  Fly   259 RSFSDYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHL 323
            ::|:..:..:||:..||.|:||.||.|:.||:.:..||.|.:||.|.:...|.||.|.:|:|::|
Mosquito   364 KAFAQQANMVKHQMLHTGEKPFKCKSCDKAFSQNANLKKHEMVHLGIRPHTCPLCTKSYSQYSNL 428

  Fly   324 TTHYRSNAHRRNMQKAD 340
            ..|..|  |::...|.:
Mosquito   429 KKHLLS--HQKQAIKQE 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 4/19 (21%)
COG5048 222..>276 CDD:227381 17/53 (32%)
C2H2 Zn finger 226..246 CDD:275368 5/19 (26%)
zf-H2C2_2 238..262 CDD:290200 8/23 (35%)
C2H2 Zn finger 254..274 CDD:275368 5/19 (26%)
zf-H2C2_2 269..291 CDD:290200 12/21 (57%)
C2H2 Zn finger 282..302 CDD:275368 8/19 (42%)
zf-H2C2_2 295..319 CDD:290200 10/23 (43%)
C2H2 Zn finger 310..328 CDD:275368 8/17 (47%)
AgaP_AGAP005978XP_556655.3 C2H2 Zn finger 51..71 CDD:275368
C2H2 Zn finger 79..99 CDD:275368
C2H2 Zn finger 107..127 CDD:275368
COG5048 131..446 CDD:227381 49/147 (33%)
C2H2 Zn finger 135..155 CDD:275368
C2H2 Zn finger 163..183 CDD:275368
C2H2 Zn finger 191..211 CDD:275368
C2H2 Zn finger 219..239 CDD:275368
C2H2 Zn finger 247..267 CDD:275368
C2H2 Zn finger 275..295 CDD:275368
C2H2 Zn finger 303..323 CDD:275368 4/19 (21%)
C2H2 Zn finger 331..351 CDD:275368 5/19 (26%)
C2H2 Zn finger 359..379 CDD:275368 5/19 (26%)
zf-H2C2_2 371..396 CDD:290200 12/24 (50%)
C2H2 Zn finger 387..407 CDD:275368 8/19 (42%)
C2H2 Zn finger 415..435 CDD:275368 9/21 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.