Sequence 1: | NP_649824.1 | Gene: | ranshi / 41041 | FlyBaseID: | FBgn0037620 | Length: | 346 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_689586.3 | Gene: | ZNF684 / 127396 | HGNCID: | 28418 | Length: | 378 | Species: | Homo sapiens |
Alignment Length: | 260 | Identity: | 79/260 - (30%) |
---|---|---|---|
Similarity: | 114/260 - (43%) | Gaps: | 41/260 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 78 HSQDDEDFLRICQESPKSVLEQEELELDLAEISIEVERLDDLNE----GPIQSSGFK-VEDILNE 137
Fly 138 SKINEDEPNNEDDIDYSEMDYLIYESDTEVDAKQELKSDSENPKKR----RNRRNPRDSNRTFFC 198
Fly 199 EECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFSD 263
Fly 264 YSTRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHYR 328
Fly 329 328 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ranshi | NP_649824.1 | zf-AD | 5..77 | CDD:214871 | |
C2H2 Zn finger | 198..218 | CDD:275368 | 5/19 (26%) | ||
COG5048 | 222..>276 | CDD:227381 | 20/53 (38%) | ||
C2H2 Zn finger | 226..246 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 238..262 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 254..274 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 269..291 | CDD:290200 | 10/21 (48%) | ||
C2H2 Zn finger | 282..302 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 295..319 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 310..328 | CDD:275368 | 7/17 (41%) | ||
ZNF684 | NP_689586.3 | KRAB | 8..68 | CDD:214630 | |
KRAB | 8..47 | CDD:279668 | |||
C2H2 Zn finger | 161..181 | CDD:275368 | 4/20 (20%) | ||
zf-H2C2_2 | 173..198 | CDD:290200 | 6/25 (24%) | ||
COG5048 | <185..345 | CDD:227381 | 52/135 (39%) | ||
zf-C2H2 | 187..209 | CDD:278523 | 6/21 (29%) | ||
C2H2 Zn finger | 189..209 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 201..224 | CDD:290200 | 7/22 (32%) | ||
C2H2 Zn finger | 217..237 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 230..253 | CDD:290200 | 11/22 (50%) | ||
C2H2 Zn finger | 245..265 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 273..293 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 285..308 | CDD:290200 | 10/22 (45%) | ||
C2H2 Zn finger | 301..321 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 314..336 | CDD:290200 | 4/6 (67%) | ||
COG5048 | 325..>378 | CDD:227381 | |||
C2H2 Zn finger | 329..349 | CDD:275368 | |||
zf-H2C2_2 | 341..366 | CDD:290200 | |||
C2H2 Zn finger | 357..377 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |