DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and ZNF792

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_787068.3 Gene:ZNF792 / 126375 HGNCID:24751 Length:632 Species:Homo sapiens


Alignment Length:144 Identity:54/144 - (37%)
Similarity:77/144 - (53%) Gaps:0/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 RTFFCEECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCS 258
            :.:.|.:||.....|.:.|.|.:.|.|.....|..|...|...:.|.:|.|.||||:|:||..|.
Human   364 KPYECSDCGKFFSQRSNLIHHKRVHTGRSAHECSECGKSFNCNSSLIKHWRVHTGERPYKCNECG 428

  Fly   259 RSFSDYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHL 323
            :.||..::.::|:..||.|||..|.||..||:.|..|..|..|||||:.:.|:.|.||||:.:.|
Human   429 KFFSHIASLIQHQIVHTGERPHGCGECGKAFSRSSDLMKHQRVHTGERPYECNECGKLFSQSSSL 493

  Fly   324 TTHYRSNAHRRNMQ 337
            .:|.|.:...|..|
Human   494 NSHRRLHTGERPYQ 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 6/19 (32%)
COG5048 222..>276 CDD:227381 18/53 (34%)
C2H2 Zn finger 226..246 CDD:275368 6/19 (32%)
zf-H2C2_2 238..262 CDD:290200 11/23 (48%)
C2H2 Zn finger 254..274 CDD:275368 5/19 (26%)
zf-H2C2_2 269..291 CDD:290200 11/21 (52%)
C2H2 Zn finger 282..302 CDD:275368 8/19 (42%)
zf-H2C2_2 295..319 CDD:290200 12/23 (52%)
C2H2 Zn finger 310..328 CDD:275368 8/17 (47%)
ZNF792NP_787068.3 KRAB 14..74 CDD:214630
KRAB 14..53 CDD:279668
C2H2 Zn finger 256..276 CDD:275368
C2H2 Zn finger 284..304 CDD:275368
C2H2 Zn finger 312..332 CDD:275368
zf-H2C2_2 324..349 CDD:290200
C2H2 Zn finger 340..360 CDD:275368
COG5048 <348..592 CDD:227381 54/144 (38%)
zf-H2C2_2 352..377 CDD:290200 3/12 (25%)
C2H2 Zn finger 368..388 CDD:275368 6/19 (32%)
C2H2 Zn finger 396..416 CDD:275368 6/19 (32%)
C2H2 Zn finger 424..444 CDD:275368 5/19 (26%)
C2H2 Zn finger 452..472 CDD:275368 8/19 (42%)
zf-H2C2_2 464..489 CDD:290200 12/24 (50%)
C2H2 Zn finger 480..500 CDD:275368 9/19 (47%)
zf-H2C2_2 492..517 CDD:290200 5/16 (31%)
C2H2 Zn finger 508..528 CDD:275368 54/144 (38%)
zf-H2C2_2 520..545 CDD:290200
C2H2 Zn finger 536..556 CDD:275368
zf-H2C2_2 548..573 CDD:290200
C2H2 Zn finger 564..584 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.