DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and ZNF554

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001096121.1 Gene:ZNF554 / 115196 HGNCID:26629 Length:538 Species:Homo sapiens


Alignment Length:147 Identity:59/147 - (40%)
Similarity:83/147 - (56%) Gaps:0/147 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 RTFFCEECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCS 258
            :.:.|.|||.......|...|.:.|.|.|.:.||.|...||..:.|..|.|.||||||::|..|.
Human   378 KPYGCGECGKAFNRISSLTQHQRIHTGEKPYKCEDCGKSFCQSSYLILHKRTHTGEKPYECSECG 442

  Fly   259 RSFSDYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHL 323
            ::|||.|:..:||||||.|.|:.||:|..||:....|..|...|||||.:||..|.|.||:.:.|
Human   443 KAFSDRSSLNQHERTHTGENPYECKQCGRAFSQRSSLVRHERTHTGEKPYRCQECGKAFSQSSSL 507

  Fly   324 TTHYRSNAHRRNMQKAD 340
            .||.::::.::..:..|
Human   508 VTHQKTHSSQKTYKIID 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 6/19 (32%)
COG5048 222..>276 CDD:227381 26/53 (49%)
C2H2 Zn finger 226..246 CDD:275368 8/19 (42%)
zf-H2C2_2 238..262 CDD:290200 11/23 (48%)
C2H2 Zn finger 254..274 CDD:275368 9/19 (47%)
zf-H2C2_2 269..291 CDD:290200 13/21 (62%)
C2H2 Zn finger 282..302 CDD:275368 7/19 (37%)
zf-H2C2_2 295..319 CDD:290200 12/23 (52%)
C2H2 Zn finger 310..328 CDD:275368 8/17 (47%)
ZNF554NP_001096121.1 KRAB 44..84 CDD:307490
COG5048 <225..417 CDD:227381 12/38 (32%)
C2H2 Zn finger 276..291 CDD:275368
C2H2 Zn finger 293..318 CDD:275368
zf-C2H2 324..346 CDD:306579
C2H2 Zn finger 326..346 CDD:275368
COG5048 <350..532 CDD:227381 59/147 (40%)
C2H2 Zn finger 354..374 CDD:275368
C2H2 Zn finger 382..402 CDD:275368 6/19 (32%)
C2H2 Zn finger 410..430 CDD:275368 8/19 (42%)
C2H2 Zn finger 438..458 CDD:275368 9/19 (47%)
C2H2 Zn finger 466..486 CDD:275368 7/19 (37%)
C2H2 Zn finger 494..514 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.