DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and AgaP_AGAP013032

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_003436669.1 Gene:AgaP_AGAP013032 / 11175757 VectorBaseID:AGAP013032 Length:498 Species:Anopheles gambiae


Alignment Length:118 Identity:24/118 - (20%)
Similarity:40/118 - (33%) Gaps:32/118 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 DEDFLRICQESPKSVLEQEELELDLAEISIEVERLDDLNEGPIQSSGFKVEDILNESKINEDEPN 146
            |.|.:|.....|                    |.|..|..|.::......:.|..|..::||...
Mosquito   259 DPDIIRQAMAHP--------------------EYLTALERGEMKHGSVLYDHIDLEDDLDEDNGE 303

  Fly   147 NEDDIDYSEMDYLIYESDTE-----------VDAKQELKSDSENPK-KRRNRR 187
            .:||:::.|.::...:.|.|           .|...:..:|.|.|| ...||:
Mosquito   304 EDDDVEFIEPEHETLDDDAERYIIATLDAGLKDDDDDDDNDEEMPKWSTENRQ 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871
C2H2 Zn finger 198..218 CDD:275368
COG5048 222..>276 CDD:227381
C2H2 Zn finger 226..246 CDD:275368
zf-H2C2_2 238..262 CDD:290200
C2H2 Zn finger 254..274 CDD:275368
zf-H2C2_2 269..291 CDD:290200
C2H2 Zn finger 282..302 CDD:275368
zf-H2C2_2 295..319 CDD:290200
C2H2 Zn finger 310..328 CDD:275368
AgaP_AGAP013032XP_003436669.1 zf-AD <1..41 CDD:285071
Forkhead 162..250 CDD:278670
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.