DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and LOC108190743

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_017212654.1 Gene:LOC108190743 / 108190743 -ID:- Length:494 Species:Danio rerio


Alignment Length:324 Identity:86/324 - (26%)
Similarity:132/324 - (40%) Gaps:54/324 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRTCGKRTNAERSLNIFEKRNQTTLEHIKLLTGAVLKNCSTLPNRLCASCQTCLQQAISFRERCL 70
            |.:|||....:..|.|.|:::......|                  |..|:.|..   :.:||.|
Zfish   183 CTSCGKAFACQSYLLIHERKHSEPKVFI------------------CWRCRKCFP---TLQERKL 226

  Fly    71 EVQRELLHSQDDEDFLRICQESPKSVLEQEELELDLAEISIEVERLDDLNEGPIQSSGFKVE-DI 134
            .::..|.    :::|  .|::..|:.|...:|::.:                ...|...:|: |:
Zfish   227 HLKEHLA----EKEF--HCEQCGKNFLLSNQLKVHM----------------KTHSGDQRVQCDV 269

  Fly   135 LNESKINEDEPNNEDDIDYSEMDYLIYESDTEVDAKQELKSDSENPKKRRNRRNPRDSNRTFFCE 199
            .|:|...:........|...|..|.........:.|..:|          |......:.|.:.|.
Zfish   270 CNKSFSTKANLEVHKRIHTGERPYKCPHCKKSFNYKSYMK----------NHIRIHTNERPYQCS 324

  Fly   200 ECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFSDY 264
            |||...|...|...|.|.|...|...|::|:.||...|.|..|.|.||||||:.|..|.:.....
Zfish   325 ECGKTFKTNNSLNSHLKFHSEEKPHQCKYCDKRFRMKANLNVHERIHTGEKPYLCAECGKRVKTS 389

  Fly   265 STRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHYR 328
            :..:.|:|.||.|:|::|..|..:|:...||.|||..||||:.::|..|||.|:|...|.||.|
Zfish   390 TELVCHQRIHTGEKPYLCNICGRSFSKPTILINHMRTHTGERPYKCSHCDKTFARSDVLKTHER 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871 14/70 (20%)
C2H2 Zn finger 198..218 CDD:275368 8/19 (42%)
COG5048 222..>276 CDD:227381 20/53 (38%)
C2H2 Zn finger 226..246 CDD:275368 8/19 (42%)
zf-H2C2_2 238..262 CDD:290200 11/23 (48%)
C2H2 Zn finger 254..274 CDD:275368 4/19 (21%)
zf-H2C2_2 269..291 CDD:290200 9/21 (43%)
C2H2 Zn finger 282..302 CDD:275368 8/19 (42%)
zf-H2C2_2 295..319 CDD:290200 13/23 (57%)
C2H2 Zn finger 310..328 CDD:275368 9/17 (53%)
LOC108190743XP_017212654.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.