DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and LOC101732880

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_031757797.1 Gene:LOC101732880 / 101732880 -ID:- Length:535 Species:Xenopus tropicalis


Alignment Length:172 Identity:62/172 - (36%)
Similarity:79/172 - (45%) Gaps:28/172 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 NRRNPRDSNRTFFCEECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGE 249
            :.||...|.:.|.|.|||.....|...:.|...|...|.|.|..||..|.:..:|..|.|.||||
 Frog   360 SHRNSHKSEKPFSCSECGKRFGSRSHLVSHQISHTEEKPFSCPVCEKCFKSKPQLTEHYRIHTGE 424

  Fly   250 KPFKCRHCSRSFSDYSTRLKHERTHTNERPFVCKECNNAF------------------------T 290
            |||.|..|.:||:..|..:.|.|.||.||||.|.||..:|                        .
 Frog   425 KPFSCSTCGKSFTQRSHLIGHVRLHTGERPFSCSECGKSFGLQRDLNKHMKFHSGEKPFTCNECG 489

  Fly   291 TSYI----LKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHYR 328
            .|::    ||.|.|:|||||.|.|.:|:|.|...::|..|:|
 Frog   490 KSFLLQGHLKRHFLIHTGEKPFSCSICEKRFGLQSNLNRHFR 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 6/19 (32%)
COG5048 222..>276 CDD:227381 24/53 (45%)
C2H2 Zn finger 226..246 CDD:275368 7/19 (37%)
zf-H2C2_2 238..262 CDD:290200 13/23 (57%)
C2H2 Zn finger 254..274 CDD:275368 7/19 (37%)
zf-H2C2_2 269..291 CDD:290200 12/45 (27%)
C2H2 Zn finger 282..302 CDD:275368 9/47 (19%)
zf-H2C2_2 295..319 CDD:290200 14/23 (61%)
C2H2 Zn finger 310..328 CDD:275368 6/17 (35%)
LOC101732880XP_031757797.1 KRAB_A-box 110..141 CDD:413388
C2H2 Zn finger 289..309 CDD:275368
COG5048 <313..473 CDD:227381 44/112 (39%)
C2H2 Zn finger 317..337 CDD:275368
C2H2 Zn finger 345..365 CDD:275368 2/4 (50%)
C2H2 Zn finger 373..393 CDD:275368 6/19 (32%)
C2H2 Zn finger 401..421 CDD:275368 7/19 (37%)
C2H2 Zn finger 429..449 CDD:275368 7/19 (37%)
C2H2 Zn finger 457..477 CDD:275368 4/19 (21%)
COG5048 481..>535 CDD:227381 18/51 (35%)
C2H2 Zn finger 485..505 CDD:275368 5/19 (26%)
C2H2 Zn finger 513..533 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.