DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and znf131

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_017946303.2 Gene:znf131 / 100491098 XenbaseID:XB-GENE-982736 Length:647 Species:Xenopus tropicalis


Alignment Length:365 Identity:91/365 - (24%)
Similarity:143/365 - (39%) Gaps:114/365 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 QAISFRER---CLEVQRELLHSQDDEDFLRICQES-------PKSVLEQEELELDLAEISIEVER 115
            :|:.||.:   .:|.:.. ..|.|.....:|.:.|       |.|..|..|:|:::.|.:||   
 Frog   150 KALEFRNKESIIIEAEAR-TESTDSIKKWKIAESSEVITETLPASDGEPLEIEVEIGEKTIE--- 210

  Fly   116 LDD----LNEGPIQSSGFK---------------VEDILNESKIN------EDEPNNEDD----- 150
            |||    :.|........|               :.||.::.:..      |:|.:||.|     
 Frog   211 LDDNVATMEEVATAEQSIKYIQSTATSDDSALALLADITSKYRHGERKRQLEEESSNESDAAGKQ 275

  Fly   151 IDYSE-MDY-------------------LIYESDTEVDAKQELKSDSENPKKRRNRRNPRDSNRT 195
            ::.|| |:.                   |.|.      .|:.:||.|.:               |
 Frog   276 VEGSEIMEVHLSHVNNMFHCQKCNRSFKLFYH------FKEHMKSHSSD---------------T 319

  Fly   196 FFCEECGNHIKDRISFILH--C---------KRHR-GVKEFGCEFCEDRFCTPAELKRHIRKHTG 248
            |.||.|.......|::..|  |         ||.| |.|...|::|:.:|......|.|:|||||
 Frog   320 FKCEICNKRYVREIAWKQHLTCYHMDESTANKRPRPGKKIHVCQYCDKQFDHFGHFKEHLRKHTG 384

  Fly   249 EKPFKCRHCSRSFSDYSTRLKH--------ERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGE 305
            ||||:|.:|...|:..||...|        ......::.:.|:.||:.|......|:|:::||||
 Frog   385 EKPFECPNCHEHFARNSTLKCHLSACQYGVGAKKGRKKLYECQVCNSIFNCWDQFKDHLVLHTGE 449

  Fly   306 KAFRCDLCDKLFSRYTHLTTHYRSNAHRRNMQKADTIFDK 345
            |...|.|||..|.:.:.|         |:::|:|..|.::
 Frog   450 KPNHCTLCDMWFMQGSEL---------RKHLQEAHNISER 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871 4/18 (22%)
C2H2 Zn finger 198..218 CDD:275368 7/30 (23%)
COG5048 222..>276 CDD:227381 21/61 (34%)
C2H2 Zn finger 226..246 CDD:275368 6/19 (32%)
zf-H2C2_2 238..262 CDD:290200 13/23 (57%)
C2H2 Zn finger 254..274 CDD:275368 6/27 (22%)
zf-H2C2_2 269..291 CDD:290200 5/29 (17%)
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
zf-H2C2_2 295..319 CDD:290200 12/23 (52%)
C2H2 Zn finger 310..328 CDD:275368 6/17 (35%)
znf131XP_017946303.2 BTB_POZ_ZBTB35_ZNF131 47..159 CDD:349530 3/8 (38%)
COG5048 <264..476 CDD:227381 66/241 (27%)
C2H2 Zn finger 295..315 CDD:275368 4/25 (16%)
C2H2 Zn finger 362..382 CDD:275368 6/19 (32%)
zf-H2C2_2 374..399 CDD:404364 14/24 (58%)
C2H2 Zn finger 390..446 CDD:275368 12/55 (22%)
C2H2 Zn finger 454..471 CDD:275368 7/25 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.