Sequence 1: | NP_649824.1 | Gene: | ranshi / 41041 | FlyBaseID: | FBgn0037620 | Length: | 346 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002937462.1 | Gene: | LOC100489584 / 100489584 | -ID: | - | Length: | 400 | Species: | Xenopus tropicalis |
Alignment Length: | 288 | Identity: | 79/288 - (27%) |
---|---|---|---|
Similarity: | 119/288 - (41%) | Gaps: | 76/288 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 107 AEISIEVERLDDLNEGPIQSSGFKVEDILNESKINEDEPNNEDDIDY-SEMDYLIYESD------ 164
Fly 165 -------------------TEVDAKQEL--KSDSE--NPKKR----------------------- 183
Fly 184 RNR-----------RNPRDSNRTFFCEECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPA 237
Fly 238 ELKRHIRKHTGEKPFKCRHCSRSFSDYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVH 302
Fly 303 TGEKAFRCDLCDKLFSRYTHLTTHYRSN 330 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ranshi | NP_649824.1 | zf-AD | 5..77 | CDD:214871 | |
C2H2 Zn finger | 198..218 | CDD:275368 | 6/19 (32%) | ||
COG5048 | 222..>276 | CDD:227381 | 20/53 (38%) | ||
C2H2 Zn finger | 226..246 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 238..262 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 254..274 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 269..291 | CDD:290200 | 12/21 (57%) | ||
C2H2 Zn finger | 282..302 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 295..319 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 310..328 | CDD:275368 | 7/17 (41%) | ||
LOC100489584 | XP_002937462.1 | COG5048 | <144..297 | CDD:227381 | 54/135 (40%) |
C2H2 Zn finger | 146..166 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 158..183 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 174..194 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 186..211 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 202..222 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 215..239 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 230..250 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 242..267 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 258..278 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 270..294 | CDD:290200 | 4/9 (44%) | ||
C2H2 Zn finger | 286..306 | CDD:275368 | |||
C2H2 Zn finger | 314..334 | CDD:275368 | |||
zf-H2C2_2 | 326..350 | CDD:290200 | |||
C2H2 Zn finger | 342..362 | CDD:275368 | |||
zf-H2C2_2 | 354..379 | CDD:290200 | |||
C2H2 Zn finger | 370..390 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |