DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and Zfp958

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_038944925.1 Gene:Zfp958 / 100302405 RGDID:2311392 Length:495 Species:Rattus norvegicus


Alignment Length:155 Identity:57/155 - (36%)
Similarity:86/155 - (55%) Gaps:1/155 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 KSDSENPKKRRNRRNPRDSNRTFFCEECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAE 238
            |:.|:....:|::|. ....:...|.:||.......|...|.:.|.|.|.:||..|:..|...:.
  Rat   138 KAFSDQNTLQRHKRT-HSEEKPCKCNQCGKAFAHHSSLRKHERTHTGEKPYGCNQCDKAFACHSS 201

  Fly   239 LKRHIRKHTGEKPFKCRHCSRSFSDYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVHT 303
            |:||.|.||||||::|..|.::|:.:|:..|||||||.|:|:.|.:|:.||.....|:.|...||
  Rat   202 LRRHERTHTGEKPYECNQCDKAFAYHSSLQKHERTHTGEKPYGCNQCDKAFACHSSLRKHERTHT 266

  Fly   304 GEKAFRCDLCDKLFSRYTHLTTHYR 328
            |||.:.|:.|.|.|:.::.|..|.|
  Rat   267 GEKPYECNQCGKAFACHSTLRKHER 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 5/19 (26%)
COG5048 222..>276 CDD:227381 25/53 (47%)
C2H2 Zn finger 226..246 CDD:275368 7/19 (37%)
zf-H2C2_2 238..262 CDD:290200 12/23 (52%)
C2H2 Zn finger 254..274 CDD:275368 8/19 (42%)
zf-H2C2_2 269..291 CDD:290200 13/21 (62%)
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
zf-H2C2_2 295..319 CDD:290200 11/23 (48%)
C2H2 Zn finger 310..328 CDD:275368 6/17 (35%)
Zfp958XP_038944925.1 KRAB 4..44 CDD:396083
C2H2 Zn finger 80..97 CDD:275368
C2H2 Zn finger 105..125 CDD:275368
COG5048 129..490 CDD:227381 57/155 (37%)
C2H2 Zn finger 133..153 CDD:275368 4/15 (27%)
C2H2 Zn finger 161..181 CDD:275368 5/19 (26%)
C2H2 Zn finger 189..209 CDD:275368 7/19 (37%)
C2H2 Zn finger 217..237 CDD:275368 8/19 (42%)
C2H2 Zn finger 245..265 CDD:275368 6/19 (32%)
C2H2 Zn finger 273..293 CDD:275368 7/19 (37%)
C2H2 Zn finger 301..321 CDD:275368
C2H2 Zn finger 329..349 CDD:275368
C2H2 Zn finger 357..377 CDD:275368
C2H2 Zn finger 385..405 CDD:275368
C2H2 Zn finger 413..433 CDD:275368
C2H2 Zn finger 441..461 CDD:275368
C2H2 Zn finger 469..489 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.