| Sequence 1: | NP_649824.1 | Gene: | ranshi / 41041 | FlyBaseID: | FBgn0037620 | Length: | 346 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001116088.1 | Gene: | zgc:171435 / 100142638 | ZFINID: | ZDB-GENE-080305-7 | Length: | 291 | Species: | Danio rerio |
| Alignment Length: | 224 | Identity: | 73/224 - (32%) |
|---|---|---|---|
| Similarity: | 96/224 - (42%) | Gaps: | 47/224 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 160 IYESDTE------VDAK-QELKSDSENPKKRRNRRNPRDSNRTFF----------CEECGNHIKD 207
Fly 208 RISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFSDYSTRLK-HE 271
Fly 272 RTHTNERPFVCKECNNAFTTSYI----------------------------LKNHMLVHTGEKAF 308
Fly 309 RCDLCDKLFSRYTHLTTHYRSNAHRRNMQ 337 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ranshi | NP_649824.1 | zf-AD | 5..77 | CDD:214871 | |
| C2H2 Zn finger | 198..218 | CDD:275368 | 5/19 (26%) | ||
| COG5048 | 222..>276 | CDD:227381 | 25/54 (46%) | ||
| C2H2 Zn finger | 226..246 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 238..262 | CDD:290200 | 10/23 (43%) | ||
| C2H2 Zn finger | 254..274 | CDD:275368 | 9/20 (45%) | ||
| zf-H2C2_2 | 269..291 | CDD:290200 | 12/22 (55%) | ||
| C2H2 Zn finger | 282..302 | CDD:275368 | 9/47 (19%) | ||
| zf-H2C2_2 | 295..319 | CDD:290200 | 13/23 (57%) | ||
| C2H2 Zn finger | 310..328 | CDD:275368 | 8/17 (47%) | ||
| zgc:171435 | NP_001116088.1 | zf-C2H2 | 62..84 | CDD:278523 | 5/21 (24%) |
| C2H2 Zn finger | 64..84 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 76..100 | CDD:290200 | 9/23 (39%) | ||
| COG5048 | <88..249 | CDD:227381 | 54/145 (37%) | ||
| C2H2 Zn finger | 92..112 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 104..129 | CDD:290200 | 11/25 (44%) | ||
| C2H2 Zn finger | 120..140 | CDD:275368 | 9/20 (45%) | ||
| zf-H2C2_2 | 132..157 | CDD:290200 | 13/24 (54%) | ||
| C2H2 Zn finger | 148..168 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 176..196 | CDD:275368 | 3/19 (16%) | ||
| zf-H2C2_2 | 188..211 | CDD:290200 | 12/22 (55%) | ||
| C2H2 Zn finger | 204..224 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 216..240 | CDD:290200 | 5/16 (31%) | ||
| C2H2 Zn finger | 232..252 | CDD:275368 | 73/224 (33%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||