DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and ZNF730

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_016881603.1 Gene:ZNF730 / 100129543 HGNCID:32470 Length:514 Species:Homo sapiens


Alignment Length:322 Identity:84/322 - (26%)
Similarity:121/322 - (37%) Gaps:82/322 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRTCGKRTNAERSLNIFEKRNQTTLEHIKLLTGAVLKNCSTLPNRLCASCQTCLQQAISFRERCL 70
            |..|||..|        :..|.||  |.::.||       ..|.: |..|.....|:.:..|   
Human   269 CEKCGKFFN--------QSTNLTT--HKRIHTG-------EKPYK-CEECGKAFNQSSNLTE--- 312

  Fly    71 EVQRELLHSQDDEDFLRICQESPKSVLEQEELELDLAEISIEVERLDDLNEGPIQSSGFKVEDIL 135
               .:.:|:::..   ..|::..|:                                 ||....|
Human   313 ---HKKIHTKEQP---YKCEKCGKA---------------------------------FKWSSTL 338

  Fly   136 NESKINEDEPNNEDDIDYSEMDYLIYESDTEVDAKQELKSDSENPKKRRNRRN-PRDSNRTFFCE 199
            .:.|          .|...|..|           |.|....:.|.....||.. .....:.:..:
Human   339 TKHK----------RIHNGEKPY-----------KCEECGKAFNRSSTLNRHKITHTGGKPYKYK 382

  Fly   200 ECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFSDY 264
            |||.......:..:|...|...|.:.||.|...|...:.|..|.|.||||||:||..|.|:|:..
Human   383 ECGKAFNQSSTLTIHKIIHTVEKFYKCEECGKAFSRISHLTTHKRIHTGEKPYKCEECGRAFNQS 447

  Fly   265 STRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTH 326
            ||...|:|.||.|:|:.|:||..||..|..|..|.::|:|||.::|..|.|.|.|::|||.|
Human   448 STLTTHKRIHTGEKPYECEECGKAFNRSSTLTTHKIIHSGEKIYKCKECGKAFRRFSHLTRH 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871 16/70 (23%)
C2H2 Zn finger 198..218 CDD:275368 4/19 (21%)
COG5048 222..>276 CDD:227381 24/53 (45%)
C2H2 Zn finger 226..246 CDD:275368 7/19 (37%)
zf-H2C2_2 238..262 CDD:290200 13/23 (57%)
C2H2 Zn finger 254..274 CDD:275368 8/19 (42%)
zf-H2C2_2 269..291 CDD:290200 11/21 (52%)
C2H2 Zn finger 282..302 CDD:275368 8/19 (42%)
zf-H2C2_2 295..319 CDD:290200 10/23 (43%)
C2H2 Zn finger 310..328 CDD:275368 9/17 (53%)
ZNF730XP_016881603.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.