| Sequence 1: | NP_649824.1 | Gene: | ranshi / 41041 | FlyBaseID: | FBgn0037620 | Length: | 346 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_005171194.1 | Gene: | bcl6ab / 100001936 | ZFINID: | ZDB-GENE-030131-7523 | Length: | 566 | Species: | Danio rerio |
| Alignment Length: | 220 | Identity: | 62/220 - (28%) |
|---|---|---|---|
| Similarity: | 95/220 - (43%) | Gaps: | 35/220 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 131 VEDILNESKINEDEPNNEDD--IDYSEMDYLIYESDTEVDAK-------------QELKSDSENP 180
Fly 181 KKRRNRRNPRDSNRTFFCEEC-------GNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAE 238
Fly 239 LKRHIRKHTGEKPFKCRHCSRSFSDYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVHT 303
Fly 304 GEKAFRCDLCDKLFSRYTHLTTHYR 328 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ranshi | NP_649824.1 | zf-AD | 5..77 | CDD:214871 | |
| C2H2 Zn finger | 198..218 | CDD:275368 | 5/26 (19%) | ||
| COG5048 | 222..>276 | CDD:227381 | 22/53 (42%) | ||
| C2H2 Zn finger | 226..246 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 238..262 | CDD:290200 | 13/23 (57%) | ||
| C2H2 Zn finger | 254..274 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 269..291 | CDD:290200 | 8/21 (38%) | ||
| C2H2 Zn finger | 282..302 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 295..319 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 310..328 | CDD:275368 | 6/17 (35%) | ||
| bcl6ab | XP_005171194.1 | BTB | 22..126 | CDD:279045 | |
| BTB | 33..128 | CDD:197585 | |||
| C2H2 Zn finger | 412..433 | CDD:275368 | 5/26 (19%) | ||
| zf-H2C2_2 | 426..450 | CDD:290200 | 7/29 (24%) | ||
| C2H2 Zn finger | 441..461 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 453..478 | CDD:290200 | 14/24 (58%) | ||
| C2H2 Zn finger | 469..489 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 481..506 | CDD:290200 | 8/24 (33%) | ||
| C2H2 Zn finger | 497..517 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 510..534 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 525..543 | CDD:275368 | 6/17 (35%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||