DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8159 and DOT5

DIOPT Version :9

Sequence 1:NP_649823.2 Gene:CG8159 / 41040 FlyBaseID:FBgn0037619 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_172787.1 Gene:DOT5 / 837889 AraportID:AT1G13290 Length:302 Species:Arabidopsis thaliana


Alignment Length:135 Identity:31/135 - (22%)
Similarity:50/135 - (37%) Gaps:46/135 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 KKGGKGENRTK-----VTLPVFFC-DQCGNNITGKSS--------FDRHLRKHSGIRPFQC-ELC 225
            :||.:....||     :.||.:.| :.|.|||....|        ...|.::..|.:||:| :.|
plant   128 RKGPESLRGTKSSSSILRLPCYCCAEGCKNNIDHPRSKPLKDFRTLQTHYKRKHGAKPFRCRKKC 192

  Fly   226 PARFLSSGELKGHQVMHTGDRKFQCRYCDRTYVNYSGRLRHERTHTNDRPFICAQCGKSFTNSYI 290
            ...|...|:.:.|:           :.|        |:|           :.|. ||..|.:...
plant   193 EKTFAVRGDWRTHE-----------KNC--------GKL-----------WFCV-CGSDFKHKRS 226

  Fly   291 LKNHM 295
            ||:|:
plant   227 LKDHV 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8159NP_649823.2 zf-AD 5..78 CDD:214871
C2H2 Zn finger 194..214 CDD:275368 7/28 (25%)
COG5048 <197..322 CDD:227381 24/108 (22%)
zf-H2C2_2 206..231 CDD:290200 8/33 (24%)
C2H2 Zn finger 222..242 CDD:275368 5/20 (25%)
C2H2 Zn finger 250..270 CDD:275368 3/19 (16%)
zf-H2C2_2 265..287 CDD:290200 4/21 (19%)
C2H2 Zn finger 278..298 CDD:275368 7/18 (39%)
zf-H2C2_2 291..315 CDD:290200 3/5 (60%)
C2H2 Zn finger 306..328 CDD:275368
DOT5NP_172787.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.