DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8159 and Zfp110

DIOPT Version :9

Sequence 1:	NP_649823.2	Gene:	CG8159 / 41040	FlyBaseID:	FBgn0037619	Length:	399	Species:	Drosophila melanogaster
Sequence 2:	NP_001347505.1	Gene:	Zfp110 / 65020	MGIID:	1890378	Length:	832	Species:	Mus musculus

Alignment Length:	133	Identity:	51/133 - (38%)
Similarity:	72/133 - (54%)	Gaps:	4/133 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly   194 CDQCGNNITGKSSFDRHLRKHSGIRPFQCELCPARFLSSGELKGHQVMHTGDRKFQCRYCDRTYV 258
            |.:||........|..|.:.|:|.||:.|..|...|:.|..|..|..:|:|:|.|:|..|.||:.
Mouse   690 CSECGKLFRNARYFSVHKKIHTGERPYMCMACGKAFVQSSSLTQHLRIHSGERPFECSECGRTFN 754

  Fly   259 NYSGRLRHERTHTNDRPFICAQCGKSFTNSYILKNHMLIHTGERLFRCELCHRSFARPTHL---- 319
            :.|...:|.||||..:|:.|.:|||:|..|..|..|...|||||.:.|..|.::|.:.:||
Mouse   755 DRSAISQHLRTHTGAKPYHCERCGKAFRQSSHLTRHERTHTGERPYVCIKCGKAFTQSSHLIGHQ 819

  Fly   320 KTH 322
            |||
Mouse   820 KTH 822

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG8159	NP_649823.2	zf-AD	5..78	CDD:214871
		C2H2 Zn finger	194..214	CDD:275368	5/19 (26%)
		COG5048	<197..322	CDD:227381	48/128 (38%)
		zf-H2C2_2	206..231	CDD:290200	9/24 (38%)
		C2H2 Zn finger	222..242	CDD:275368	6/19 (32%)
		C2H2 Zn finger	250..270	CDD:275368	7/19 (37%)
		zf-H2C2_2	265..287	CDD:290200	11/21 (52%)
		C2H2 Zn finger	278..298	CDD:275368	8/19 (42%)
		zf-H2C2_2	291..315	CDD:290200	10/23 (43%)
		C2H2 Zn finger	306..328	CDD:275368	8/21 (38%)
Zfp110	NP_001347505.1	KRAB	18..77	CDD:214630
		SCAN	159..246	CDD:307924
		KRAB	283..324	CDD:307490
		C2H2 Zn finger	663..682	CDD:275370
		C2H2 Zn finger	690..710	CDD:275368	5/19 (26%)
		zf-H2C2_2	702..727	CDD:316026	9/24 (38%)
		C2H2 Zn finger	718..738	CDD:275368	6/19 (32%)
		zf-H2C2_2	730..754	CDD:316026	10/23 (43%)
		C2H2 Zn finger	746..766	CDD:275368	7/19 (37%)
		zf-C2H2	772..794	CDD:306579	8/21 (38%)
		C2H2 Zn finger	774..794	CDD:275368	8/19 (42%)
		zf-H2C2_2	786..811	CDD:316026	10/24 (42%)
		C2H2 Zn finger	802..822	CDD:275368	6/19 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000