| Sequence 1: | NP_649823.2 | Gene: | CG8159 / 41040 | FlyBaseID: | FBgn0037619 | Length: | 399 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001344376.1 | Gene: | Zfp24 / 59057 | MGIID: | 1929704 | Length: | 368 | Species: | Mus musculus |
| Alignment Length: | 230 | Identity: | 66/230 - (28%) |
|---|---|---|---|
| Similarity: | 105/230 - (45%) | Gaps: | 26/230 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 91 SVRRSARS---QRQRHEDTAPKTPASPLEVM--------IKLESLSNGDEEDDGIDHLDSCNEAD 144
Fly 145 MELAIKAMSS---STEDDGTTSPVRLKRTRRRG---LKKGGKGENRTKVTLPVFFCDQCGNNITG 203
Fly 204 KSSFDRHLRKHSGIRPFQCELCPARFLSSGELKGHQVMHTGDRKFQCRYCDRTYVNYSGRLRHER 268
Fly 269 THTNDRPFICAQCGKSFTNSYILKNHMLIHTGERL 303 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG8159 | NP_649823.2 | zf-AD | 5..78 | CDD:214871 | |
| C2H2 Zn finger | 194..214 | CDD:275368 | 7/19 (37%) | ||
| COG5048 | <197..322 | CDD:227381 | 40/107 (37%) | ||
| zf-H2C2_2 | 206..231 | CDD:290200 | 9/24 (38%) | ||
| C2H2 Zn finger | 222..242 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 250..270 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 265..287 | CDD:290200 | 11/21 (52%) | ||
| C2H2 Zn finger | 278..298 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 291..315 | CDD:290200 | 5/13 (38%) | ||
| C2H2 Zn finger | 306..328 | CDD:275368 | |||
| Zfp24 | NP_001344376.1 | SCAN | 48..159 | CDD:128708 | 4/16 (25%) |
| COG5048 | <249..329 | CDD:227381 | 27/79 (34%) | ||
| Necessary and sufficient for nuclear localization. /evidence=ECO:0000250 | 251..301 | 18/49 (37%) | |||
| C2H2 Zn finger | 253..273 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 281..301 | CDD:275368 | 7/19 (37%) | ||
| COG5048 | 305..>358 | CDD:227381 | 18/52 (35%) | ||
| C2H2 Zn finger | 309..329 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 337..357 | CDD:275368 | 9/19 (47%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||